CAZyme Information: MGYG000003674_01004

Basic Information

• Species: Prevotellamassilia sp900772575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900772575
• CAZyme ID: MGYG000003674_01004
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745		82039.48	9.9798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003674	2595876	MAG	Peru	South America

• Gene Location: Start: 6630; End: 8867 Strand: +

Full Sequence      

MLTAQHTAGNGGRGGRRRLLLKIAAICLLTLVWWWTFGTDSLTHQLDAVCRIESVTRLDV
ISPTGDTLHIAPATGQLTDDVGNATSGDSAVTSGCYVSADGHLVTAIAAIGHAGGLPGTD
SLRVMLRREADRLERLAATKHEAMRELDYYARTHTVTDDGYNSVMAFRTTMARQTATVDS
LRARLTRVMADTRPLRAVRHCRATALQTIPTRRQGVATMLRERHSLQLLGADGQLALFRT
ADGHLPPAATYIPLWPVAHTGASYMLGCFGTSDMADIVPVRLRLDCGEGSVVTDCRGRLC
GLRTGEKTVRVAAVRRFCLRTVGSAAWLGHALAGQLRRALLPPAALQVSPDTAVTVYSPR
NVSGLRRTAGCYAVLHLVDGRYTGRVGEGQPEGYGVMVYKDGSRYAGQWQGGQRAGYGTL
KDTLRQVITGIWCADTLAYGTATTATGTYTGTFDCDLRRSGRGTKVAADGTVYVGEWKEG
RREGFGFAVGERKMVRAGIWHNDRFRGEQMIYTADRVYGIDISRYQHDIGRRHYAIDWSR
VRIRRLGAANATRIRGAQDYAVSFVYVKASEGVRLRNRYYAADAAACRRRGIHVGAYHFF
STRTPGHAQALHFMRTARPRLGDLPPVLDVEPTDRQIADMGGARAMYREMAAWVRYVKAA
CGTTPVLYVSQTFVNKYMENIPADLAQCQVWIARYGEYKPYVHLLYWQLSPHGRVAGIHG
EVDINVFNGDRTQFAAYVATHRVSR

Enzyme Prediction     

No EC number prediction in MGYG000003674_01004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	520	718	1.5e-36	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	5.60e-37	518	729	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	5.55e-36	517	729	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	8.55e-36	518	727	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	3.61e-27	520	718	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	8.88e-26	517	730	63	256	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48884.1	5.37e-105	382	743	41	402
AGB29361.1	1.73e-102	369	742	33	411
VEH15425.1	1.49e-99	420	734	56	371
BCS86499.1	2.86e-99	422	741	36	355
QUB47627.1	4.77e-99	373	740	37	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	2.25e-18	519	737	18	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	1.64e-13	517	736	5	211	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	3.07e-12	562	727	42	207	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.26e-11	562	727	42	207	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	4.28e-25	517	738	67	265	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	1.45e-24	517	738	67	265	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	8.98e-24	517	738	67	265	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P25310	1.19e-12	508	736	71	288	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	4.76e-09	513	740	5	213	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999727	0.000252	0.000005	0.000002	0.000001	0.000023

TMHMM  Annotations     

start	end
20	37