CAZyme Information: MGYG000003669_01359

Basic Information

• Species: UMGS1933 sp900772235
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1933; UMGS1933 sp900772235
• CAZyme ID: MGYG000003669_01359
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452		50740.19	4.4688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003669	1541608	MAG	Peru	South America

• Gene Location: Start: 157; End: 1515 Strand: +

Full Sequence      

MTNVWKDNFDYTGLPKENIFTYDTGNNNGWGNKELEYYQANNKDNVNVDNGVLNLVAQYT
PAGVTDSTGTYNYTSARLKSVDSWLYGRFEVTAKLPNLQAGTWPAIWFLPKTEEFGAWPA
SGEIDIMEAMNNNQDLIHGSLHSANQNFKSANYHNTATITITDTENTYNVYGCTWTPEAI
EFDIDGIKYFRCERDLSKEYNPKDFPWTTPFYLLLNIAIGGSAGGNVNNALFPQTMAIKD
IKIYDLALSNFSLNNNANSNYILEKADNGYVLKSKFDEKNIIGFTSYIDGSANATIIFNK
DTNKFDIDLKNAGDSNWKIQFFGTGISLKENATYYYKAKFNSSIARKIYIGMQNSAENTP
YFLNTYNVVAGENTITGKYTATSTSDLNNFIMYLGGQDSNNPLAEHTISIEEIEVGTKVI
DNITPLHIDYTSFIKTALNNNEYNGTFAQIEV

Enzyme Prediction     

No EC number prediction in MGYG000003669_01359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	5	244	1.4e-61	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.17e-67	5	244	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	4.41e-26	75	224	101	279	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	6.17e-26	2	230	3	241	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	2.98e-18	7	244	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	1.23e-17	17	225	56	243	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPJ86686.1	0.0	1	452	74	525
QPJ84815.1	1.63e-113	1	418	125	536
QPJ85097.1	5.39e-88	2	419	161	559
QPJ86364.1	5.19e-63	18	254	222	451
BAV13066.1	7.54e-59	4	254	217	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ILN_A	1.92e-48	4	244	8	247	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6JH5_A	6.39e-37	2	244	5	231	Structureof Marine bacterial laminarinase [Aquimarina]
6XOF_A	2.40e-36	4	244	27	266	ChainA, GH16 family protein [uncultured bacterium]
6JHJ_A	4.64e-36	2	244	5	231	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
6XQF_A	1.24e-35	4	244	27	266	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45798	3.50e-49	4	244	43	282	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	3.39e-31	1	244	423	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	1.86e-25	5	225	24	242	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q27082	9.29e-25	4	244	28	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9ZG90	3.94e-21	4	248	59	291	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999945	0.000086	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003669_01359.