CAZyme Information: MGYG000003661_02371

Basic Information

• Species: Acetatifactor sp900554205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900554205
• CAZyme ID: MGYG000003661_02371
• CAZy Family: CBM35
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000003661_168|CGC1	56471.83	4.1034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003661	3177635	MAG	Peru	South America

• Gene Location: Start: 1610; End: 3124 Strand: +

Full Sequence      

MKKSRKAMVSLMALATFGSVMAGCGSSGEADGTAEQEEVFVPTVIGTYEAEDASFAGNAR
AETGKSGYSGEGYATGFEEDGDECIFHINTPESGFYDLLFGSSASGYKENYVNVDGDYFG
NLVTDSSEIAETELKRVYLDAGDHDVTVSKYWGWIDLDYLKVTTSKPIPESVYQVSAELV
NPNATENARRLMSYLADNYGKKILSGQYCDTGMYGKEFQVIKKVTDKTPAVLGLDFMEYT
PSFVENGSNGRSTDLALQCWEQGGIVTFCWHWNAPSKYLTGNWYSGFYAQYTNIDLAKIM
NGEDQEGYDLLMQDIDAIAAQLKILQDAGVPILWRPLHEASGGWFWWGASGADAYIQLYR
LLYDRLTNEYGLNNLIWVWNGQNKDWYPGDEYVDIIGEDIYPGERVYTSQVNKYLEAVEY
TTPAKMVVLSENGCVFDPDLAIRDGAMWGFWCTWNGEFVAKSTAIYSYSEQYTEAEALKK
FYSNDAVITMDELPDLKEYPIREK

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	180	492	2e-109	0.9966996699669967
CBM35	48	162	1e-23	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	9.89e-71	180	492	1	311	Glycosyl hydrolase family 26.
cd04086	CBM35_mannanase-like	2.06e-30	47	163	2	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
COG4124	ManB2	1.20e-19	289	401	144	256	Beta-mannanase [Carbohydrate transport and metabolism].
cd04083	CBM35_Lmo2446-like	4.53e-16	46	162	1	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam16990	CBM_35	7.27e-16	48	162	2	117	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42637.1	3.61e-221	42	503	68	532
QIZ03395.1	1.35e-187	49	499	56	511
AFK86179.1	1.35e-187	49	499	56	511
ANW98509.1	1.26e-176	20	499	17	506
AGC68130.1	1.26e-176	20	499	17	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.95e-102	47	493	14	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.80e-85	180	493	7	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	7.66e-59	173	494	28	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	3.72e-53	165	497	33	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	3.70e-45	180	493	24	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	3.06e-109	5	493	6	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	3.88e-82	49	499	20	463	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	2.26e-79	39	494	16	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.81e-78	48	494	24	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
Q5AWB7	7.50e-77	180	493	29	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000037	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003661_02371.