CAZyme Information: MGYG000003653_00662

Basic Information

• Species: Catenibacterium sp900540685
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium sp900540685
• CAZyme ID: MGYG000003653_00662
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635		73862.26	6.6448

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003653	2060420	MAG	Peru	South America

• Gene Location: Start: 39335; End: 41242 Strand: +

Full Sequence      

MLDNFLIKLFFEGKCLEAYKVFGAHPDKKGVRFTVYAPHARSVQVVGNFNDWDGTQHCME
RYNDGGVWTLYIEGLKQYDLYKYRIETPSGAIVDRADPYAFFSEIRPGTASKVYNLDGYR
WHDSRWMKSRSNNYDRNMNIYEANLGSWKMKKEFTDTSDGEFYSYEEMIDEIIPYVKKMG
YTHIEVMPLNEFPFDGSWGYQATGYFSATSRYGHPKQLKDFINACHKEGIGVIMDFVPAH
FVKDGHGLYQFDGGWVYEYADVNNRYSEWDSVYFDVTKDTVRSFLKSAVHFWAEEFHIDG
IRFDAVSNLIYWKGNKDFGTNNGALEFLKTMNEQIHERYPALMTIAEDSTDFPYVTKAVK
DGGLGFDYKWDMGWMNDTLKYFKEDPVYRQYDHNLLTFSMMYFYSERFILPFSHDEVVHG
KATILNKMWGLDGDKFAQAKALYTYMMTHPGKKLNFMGNELGEYKEWDERKALAWNILDY
PQHNSFHHFIQDLNKMVDEHPALYSMDYDPEGFKWLVVDDHNQSVFSYARFDKKGNCLVV
VANFIGNSHENYAVPVPFAGSYKEILNTDKADYAGSNYTNTRALRSKKGTCINEAQSIHV
KLAPFSAVVFEYHKPAKKASSPKKTKKSVVVKEGK

Enzyme Prediction     

No EC number prediction in MGYG000003653_00662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	174	463	3.1e-130	0.9966777408637874
CBM48	22	101	2e-19	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	1	619	6	633	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	7	610	608	1220	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	1	611	99	722	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	8	612	12	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK12568	PRK12568	0.0	1	614	106	730	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH27653.1	0.0	1	612	1	616
QUN11685.1	0.0	2	611	4	619
BCL56856.1	0.0	1	628	1	637
QMW75175.1	0.0	1	612	1	616
QPS14491.1	0.0	1	612	1	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	4.41e-183	7	611	134	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	6.23e-183	7	611	134	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	8.81e-183	7	611	134	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.24e-182	7	611	134	772	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	3.51e-182	7	611	134	772	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30537	2.74e-209	7	629	11	632	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus caldolyticus OX=1394 GN=glgB PE=1 SV=1
P30538	2.53e-208	7	620	11	623	1,4-alpha-glucan branching enzyme GlgB OS=Geobacillus stearothermophilus OX=1422 GN=glgB PE=1 SV=1
Q632H1	1.25e-205	14	635	10	636	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ZK / E33L) OX=288681 GN=glgB PE=3 SV=1
B9J2G8	4.63e-205	14	635	18	644	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain Q1) OX=361100 GN=glgB PE=3 SV=1
Q72YJ3	6.56e-205	14	635	18	644	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003653_00662.