CAZyme Information: MGYG000003650_01280

Basic Information

• Species: UBA1786 sp900771425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA1786; UBA1786 sp900771425
• CAZyme ID: MGYG000003650_01280
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000003650_65|CGC1	95392.85	5.7144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003650	2572020	MAG	Fiji	Oceania

• Gene Location: Start: 23272; End: 25815 Strand: -

Full Sequence      

MNRQLKHSGIALALITATVCPQQTLAQAELYPQHFNLTDVTLLDGDIKTSTLLNADLLLD
YDADRLMAPFVREAELDRQPGSKYYNWLVNHPSFGNWGQPDWTLEGHVGGHYISALALAY
AALYNPSPLSDTQDICAKLMARLDYCLAIMKDCQDAYKDNTEGLRGFIGGQPIRDVWKAL
YAGDANPFYRRGGWVPFYCQHKVLAGLRDAYVYAGNETAKDMYRQLCDWHVELVSKLDEK
TMQSVLNSEHGGVNETLADAYAIFNDAKYLEAAKKYSHRGMVEGMQQLNTTFLNNRHANT
QVPKYIGFERIAQLDDTADEYHTAALNFWKDVTDNRTVCIGGNSVNEHFLNQSNYDSYIS
QPDGPETCNSNNMLKLSEDLFDATHDSRYADFYEGTMYNHILSTQDPSTGGYVYFTTLRP
QGYKIYSKVNQGMWCCVGTGMENHSKYAHFAYTWAGTTLYVNLFMPTELKSEQFAIRQDT
QFPYEQKSRLTVNKSGKYTIAVRRPSWAGAGYGIKVNGQPAEGTIADGYMHLTYKWKKGD
VIDVELPMSLRLEECPGLNNYVAFKYGPILLAGDTELKDLQNEYAGEGRMDHSPGVRGTQ
KNINSSPLLICDRNDVLGLVSKDNTDSSADGLTFTIKAPQFVPAGSLFESKKSLTLRPFF
DTHHTRYVIYWYQQTKAEYEESDLGKQEAAKAELEERTIDFVGTGEQQSEAGHEATYSDG
STKGSYNGEFYRDAQVGGYIQYALYNTKNIKSGLSVMCRFTTADRGRVGSIYIDGQKLET
FRIPPRYNPSENGFYNVETPIPDELLKDSKGNLKSRLVFQLKAEDNSICPGLYLVRLLKE
GQAKDNK

Enzyme Prediction     

No EC number prediction in MGYG000003650_01280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	39	572	8.7e-164	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.94e-132	39	572	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.63e-90	36	574	8	503	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	5.15e-12	579	671	4	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28050.1	0.0	12	839	2	830
ASB48769.1	1.20e-194	26	840	22	793
QRX63277.1	1.60e-194	26	840	21	792
QCD36520.1	4.20e-191	6	839	4	786
QII47171.1	1.03e-189	10	839	5	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.23e-157	5	839	1	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.94e-150	6	839	2	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	2.29e-18	257	574	199	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	3.65e-16	366	582	381	615	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.47e-13	324	570	291	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.83e-08	325	553	297	541	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000551	0.763134	0.235473	0.000328	0.000274	0.000220

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003650_01280.