CAZyme Information: MGYG000003645_01642

Basic Information

• Species: CAG-831 sp900771335
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900771335
• CAZyme ID: MGYG000003645_01642
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000003645_46|CGC1	39303.96	9.3579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003645	1892545	MAG	Fiji	Oceania

• Gene Location: Start: 1206; End: 2234 Strand: -

Full Sequence      

MVLLLSLQRLLENMKKLLVLSVILGTILTASAFAQKAQSRLDYIAKYKDIAIKNMKSHGI
PASITLAQGCLESGDGLSDLAVMANNHFGIKCHKEWSGPTYYKKDDDPGKSCFRKYRKAE
ESYKDHSDFLRYRDRYAFLFDLDVTDYKGWAHGLKKAGYATNPQYPQLLIKIIEDYELYK
YDMASDNVENKSGSQKANVVPPSPAQLEAVKRVIPAKSSHWYKYSQNRPLYVRNGVTYVI
ANGGDTYASIAKEYNLFTKELLKFNDLRKDEEIAAGTVVYIEKKKKRAQKYLDCHVAEEG
DNFYDLSQRYAVRLNMLMKYNDKKSINDISKDDVIYLRDYKD

Enzyme Prediction     

No EC number prediction in MGYG000003645_01642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	49	178	4.4e-32	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	3.20e-33	42	182	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	5.14e-33	18	194	16	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	1.18e-23	48	126	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	3.59e-21	35	182	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12709	flgJ	4.18e-16	59	174	192	317	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53917.1	2.15e-112	30	324	19	298
QKG80574.1	1.01e-87	31	338	20	308
CBW22044.1	2.07e-86	13	323	2	284
ALB75916.1	2.07e-86	13	323	2	284
CAH07137.1	2.07e-86	13	323	2	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZYC_A	3.01e-10	51	185	13	156	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3VWO_A	1.63e-09	51	173	12	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3K3T_A	1.91e-09	51	185	13	156	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN4_A	7.12e-09	42	194	5	169	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	3.49e-08	42	174	5	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.69e-12	56	190	65	206	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	9.95e-10	25	177	145	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	1.97e-09	42	180	241	389	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P15931	8.69e-07	42	174	154	295	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000472	0.998665	0.000283	0.000195	0.000177	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003645_01642.