CAZyme Information: MGYG000003637_00010

Basic Information

• Species: W0P29-029 sp004558035
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; UBA953; W0P29-029; W0P29-029 sp004558035
• CAZyme ID: MGYG000003637_00010
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		43844.35	9.7534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003637	1987494	MAG	Fiji	Oceania

• Gene Location: Start: 123; End: 1319 Strand: -

Full Sequence      

MKKSMPDLPAAFPPPEKPGRPDILFVAGEHSGDELSALAVRRLLALRPELRIEAFGGHDM
RRAGARLLFDMTTFSAVGLVEVLSNFSFYSALFKKILAWIREHRPRVVCFVDFPGMNLRL
AEAMKKEGISRKGGGDVVVLHYVSPQIWAWKAKRRFKMEKLVDSLGALFPFELKCYADTR
LDVRFVGDPFAEPDYRLPVKYAADAPVLLLPGSRPKPVARIFPILLAAWEKFHASHPDKR
AVVLHPGEPVLSILRELRGKSVAARSVELVPVDDVAETQQAASAVLMSSGTMSRTCSLAG
IPGAILYKANPLTWAVGRALVGDKVKYLGMANILLDRVVYPEFLQGDATPDALAARLSAC
FDDPAVLARMRADCDALHALLRPRAGDLDAARWIAQFL

Enzyme Prediction     

No EC number prediction in MGYG000003637_00010.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	23	381	4.7e-86	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.83e-84	23	398	4	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.11e-79	23	398	4	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.94e-67	23	358	1	336	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.50e-56	20	397	5	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.23e-34	68	353	42	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY34968.1	4.91e-133	12	398	1	383
ATC65221.1	4.24e-126	9	398	7	382
AHF91230.1	4.81e-122	8	398	8	401
QYM79894.1	1.02e-119	14	398	9	380
ACB75370.1	1.57e-117	9	396	5	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.69e-34	23	357	9	341	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.69e-34	23	357	9	341	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	1.62e-54	23	372	9	354	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B8JE78	8.59e-54	23	365	11	349	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.20e-53	23	365	11	349	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	2.37e-53	23	365	11	349	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q39T49	3.62e-52	23	372	9	354	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003637_00010.