CAZyme Information: MGYG000003631_00079

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000003631_00079
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698		78424.46	6.8266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003631	1663259	MAG	Fiji	Oceania

• Gene Location: Start: 646; End: 2742 Strand: -

Full Sequence      

MTKRWMGLVLAVGLAGAAAGADGARWIWYPGDYALWRGNELQARRIEHGGGYPVFWATYG
HHPAVDFIRKVKLDRPETVEIAADGVVRITANVELPGVTSNRYVFPAGSYEICARVFNPK
RPPSLFIKGEHLRTDSSWTADWRLAGAWCQPHDPAPPAEGDARFCSVAEPPSRSAMATRP
EDPVKTERGPGGRLFADFGGETFGFVRLLGASKPGRVRVIYGESEPEAREEDPEKVDQWE
FVEVPAKGDVRLPVSRGFRYVNVVPETPGLELAGVAMDYEWLPLERKGAFRCSDARLNRI
WDVSARTLALTLREIPVEGAKRDRWTWSGDAYQSYLMNYYLFGDAGVVKDAIWYLRGGDP
VVMHVNDIMDYTFYWFVSVRDYWQFTGDRLFLKQVWGRMISLMDFAIGRLDACGRPHNGP
GDWIFIDWAPESLHNTGGVTSFEQMLFVRALEAMADVGEAVGADAKRVLSYRVRAQKLKL
EILPLFWSKEKGALMHLLKDNGELDPQLTRYPNMFGLAWGYFDEQQRKSVLENVIFNDKV
MKIQTPYMRFYELESLCALGRQSDVLREVLSYWGAMLDEGATSFWELYNPDEKGAAKYAM
YGRPYGKSLCHAWGASPIYLLGRYFLGVEPTKPGFSEYVVKPATGGLEWMEGEVPTPSGP
VKVRVDASGVTVTGNGGTGRLVWKGVETPIPPRATVRR

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	190	669	3.8e-102	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.08e-29	285	624	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.17e-04	627	664	1	39	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG4354	COG4354	0.004	382	535	454	614	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam04685	DUF608	0.009	380	465	110	190	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT23612.1	1.00e-208	1	696	25	731
QUT29108.1	1.42e-208	1	696	25	731
CBK65632.1	5.20e-208	1	696	1	707
QUR46600.1	3.55e-207	26	696	18	702
AEV99890.1	6.87e-207	5	696	13	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.72e-192	9	698	3	709	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.40e-46	253	659	500	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	8.43e-33	182	626	76	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005469	0.991991	0.001303	0.000547	0.000346	0.000310

TMHMM  Annotations     

start	end
7	29