CAZyme Information: MGYG000003625_01141

Basic Information

• Species: UBA2913 sp900770895
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; UBA2913; UBA2913 sp900770895
• CAZyme ID: MGYG000003625_01141
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000003625_150|CGC1	42620.42	5.4399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003625	2467170	MAG	Fiji	Oceania

• Gene Location: Start: 7018; End: 8124 Strand: +

Full Sequence      

MKRYSQWMADSVIARHTDLTSYWAYEFGLTLDGIAEVWRETGEEKYFDFIKSCTDTFVHD
DGSIRGYRVDEYNIDHLNNGKILLTVYQATHEEKYKLALQLLRSQIENHPRTKEGVFWHK
EIYPEQIWLDGLYMGATFYAKYVHEFTQDPVEYDDIARQFIIARRHTLDPKTGLLYHAYD
DARKQPWANPVTGLSKHFWSRSMGWYCMALVDTLEVLPEDNQYRDQIIKILNETMEALIK
VASKDSHVWYQVLDCGDRKGNYVEASGSCMIAYTLFKGVRLGFLPESMRDFAKLSYQGLL
DEFITETPMNTICLNKICYVAGLGGKPTKAYGERDGSFAYYMSEPIVTNEPKGLGPFILA
AAEYEKLV

Enzyme Prediction     

No EC number prediction in MGYG000003625_01141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	20	366	2.7e-113	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.55e-124	1	367	12	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.00e-106	4	367	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL81846.1	1.06e-238	1	367	1	367
APF23993.1	2.08e-217	1	363	1	361
QGH22292.1	2.08e-217	1	363	1	361
QGH26331.1	2.08e-217	1	363	1	361
AXB85181.1	2.95e-217	1	363	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.56e-174	1	367	1	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.07e-82	4	367	16	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.63e-82	4	367	6	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	2.71e-14	23	364	66	377	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	2.84e-13	23	306	65	335	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.13e-81	4	367	16	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.86e-36	134	363	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.86e-36	134	363	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003625_01141.