CAZyme Information: MGYG000003621_00391

Basic Information

• Species: Succinivibrio sp003456415
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp003456415
• CAZyme ID: MGYG000003621_00391
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		55161.24	6.4131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003621	1983527	MAG	Fiji	Oceania

• Gene Location: Start: 1093; End: 2556 Strand: -

Full Sequence      

MNILLLSSEVAGIIKSGGLADVAKALPVQLQAEGHDVRVVMPCYTCIEGYENFPVIGQGV
LNESSSDESIKIPYTIRKTYINKIVEVWLIDCKRYFDRTSMYGDNNQAYGDNGERFAFFA
AAALDACTRVNYWFDILHCNDWHTGIAPMLLRIKYAKDPYLSKARSVLTIHNGAFQGAFD
RSQIRMLPEIKDIYNDKITQGSYINFLKCGVFYADKINTVSPGYAKELTTYLGGHGMTQN
YLDRQQDLSGIVNGCDYSDWDPKTDQLLRIRYDLESIDQKVLGKYLLQRKLGFEMGDTPL
YGMVARLTDQKGIGLLIPILDRFLEHKVQVVIEGTGDPALQNAIAEIAQRHPGKMVFQPV
YNNVLAHQIEAAADFFLMPSIFEPCGLNQIYSLAYGTLPIVRAVGGLKDTVIDYDQDKAN
GTGFIFYDPNSEELLSCLRRTLILYLEDPNELKRIRHNAMKVRFNWSDSCQKYIELYKSA
LKKPSWQ

Enzyme Prediction     

No EC number prediction in MGYG000003621_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	478	5.6e-159	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	479	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	483	1	466	glycogen synthase GlgA.
TIGR02095	glgA	9.17e-174	1	480	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	6.15e-151	1	486	1	484	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	5.29e-97	1	479	4	478	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ94224.1	1.86e-187	1	487	1	482
BBT54611.1	7.09e-181	1	481	6	483
BBG90966.1	7.09e-181	1	481	6	483
QLL90180.1	7.09e-181	1	481	6	483
AXB09686.1	2.02e-180	1	481	6	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.72e-85	1	477	1	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.18e-84	1	477	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	9.16e-84	1	477	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	5.24e-74	1	483	1	478	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
4HLN_A	6.17e-71	2	480	126	625	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SIE1	6.61e-175	1	483	6	485	Glycogen synthase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=glgA PE=3 SV=1
A0KPQ1	2.49e-172	1	483	6	485	Glycogen synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=glgA PE=3 SV=1
Q6LKA1	1.91e-159	1	477	13	490	Glycogen synthase OS=Photobacterium profundum (strain SS9) OX=298386 GN=glgA PE=3 SV=1
B6EQL7	9.15e-159	1	477	6	480	Glycogen synthase OS=Aliivibrio salmonicida (strain LFI1238) OX=316275 GN=glgA PE=3 SV=1
Q87QX5	4.21e-150	1	481	6	484	Glycogen synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003621_00391.