CAZyme Information: MGYG000003621_00341

Basic Information

• Species: Succinivibrio sp003456415
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp003456415
• CAZyme ID: MGYG000003621_00341
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881	MGYG000003621_32|CGC2	101394.74	9.6009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003621	1983527	MAG	Fiji	Oceania

• Gene Location: Start: 49225; End: 51870 Strand: -

Full Sequence      

MISSKFRVEFTPLRLYNSWRLNGVDRITCAVNLFFYTLLFALIPFEKGAYNQVFKRFDLY
FPQIKRNKPKLFDPVRFAVQGIFLLFIKQTRAQNSNSYLISNRIYRLFNQYLVKPILTVT
TAYTQKLENDSTKVTTLLSSRYKKFVIALLIISFIFSILIVTQPFDVTYQFIFVALMWTL
AIILKSVKNRVALMLMIFISITISTRYIYWRISKTILISDGFTTFCAIVLLLAEIYAYLV
MVLSYFQVSWVLDRKPYPLPKDTSLWPSVDIFIPSYNEPLEVVKPCLLAALDLDWPKDKL
KVHMLDDGSRKDFEQYCKEIGVNYIKRDEHNHAKAGNINHALTVTNGDLVAIFDCDHVPV
RAFLQMTVGWMVHDENIALVQTPHHFYSQDPFEKNLSLHGDVPAENSLFHDFIQKGNDTW
NATMFCGSCAVIRRKPLLEIGGIAVETVTEDAHTSLRLNRKGYSSAFISMPLAAGLATES
LADHINQRIRWARGMVQIFRIDNPFTGKGLTLPQRICFANAMIHFLHGIPRIIFLIAPLP
YLFFNTYVIFATGLAILSFVLPHMLHSTMTNQRIQGNKRFYFWGVVYETILSWYITVPTL
VALISPKHGKFNVTAKGASNEATYFDWSVSKPYVLLIIINFMALVYGIYNIIFNPFCEVS
TVVVNLLWVLYNLLILGAASAVALEAKQVRASPRVLCDMKGKLELDNGYVFNVDITDFSK
EGLGIRLPIWKKSNKNLCSLFKLDQSLKVHIKHNLEDYVFNAKVKFSSNNKLGLQLELKT
KEENIKYIRCTFACADRWSHSFENLHQDTLLHGIHTLVTFGFNGYLKMLNNVPHGLKEIL
WVIVSSLKFVFSLLPQPLDIRFDRRVLRSDKNAHIFYNNED

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	270	439	5.6e-36	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	0.0	161	834	25	711	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
PRK11498	bcsA	0.0	11	855	3	840	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	4.17e-116	267	499	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	2.71e-58	227	679	13	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.97e-33	271	500	2	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ96025.1	2.43e-267	32	861	34	876
ANU67170.1	2.43e-267	32	861	34	876
ANG94663.1	6.10e-267	16	856	21	854
AVY97191.1	1.22e-266	16	856	21	854
AUJ83491.1	9.51e-266	16	856	21	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.11e-264	16	855	21	853	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.79e-89	206	728	67	610	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	8.56e-89	206	728	79	622	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	8.73e-89	206	728	80	623	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37653	5.11e-264	16	856	21	854	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	1.02e-263	16	856	21	854	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
Q8Z291	7.34e-259	16	856	21	854	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q93IN2	1.04e-258	16	856	21	854	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
P58931	5.45e-223	160	864	52	738	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
23	45
145	162
167	184
191	210
225	247
516	535
539	561
582	604
633	655
662	684