CAZyme Information: MGYG000003617_01476

Basic Information

• Species: Helicobacter_D sp900770765
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D sp900770765
• CAZyme ID: MGYG000003617_01476
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		40781.35	10.1902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003617	1743156	MAG	Fiji	Oceania

• Gene Location: Start: 439; End: 1479 Strand: +

Full Sequence      

MISFITPVFYKNTNSHFFTRSLELIEKFYNHPQIELIIADSSKNPKLKTDAKNIKIIYTY
ENDKVFSPAKAKNKGAKLATKKYLLFFDVDLAYSSEFETLLFSEIKEKLESKKENFIALP
FLYLTQSGTKLFEKTKDLKTLKESFLKGENHLVESFAANGSLIVLEKEYFLRLGGYSDFY
GHGGEDFELLHRIFAYNPHSIKNADYYTDFKAPFLAQARGFRYFMAYYSLPNFFKNLILL
HRWHPRPLSDNFYSKRPKNENLLLNKMQEFDKLNKDSIWQSKTPLVDIKEFIKNLQINSG
YPLEKNPGFFSYKKGVKPLKKPLSNKIRKLILRPKEFFKDIKLFKR

Enzyme Prediction     

No EC number prediction in MGYG000003617_01476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	264	1.5e-35	0.9601449275362319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10111	Glyco_tranf_2_2	9.03e-26	9	266	6	272	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG4092	COG4092	4.85e-17	2	263	4	286	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
cd06420	GT2_Chondriotin_Pol_N	4.55e-05	24	194	1	163	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.
pfam00535	Glycos_transf_2	2.16e-04	3	97	1	95	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.30e-04	5	97	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI34020.1	1.15e-116	1	344	1	345
QIV96492.1	1.07e-70	19	340	3	329
AAM22575.1	2.01e-50	2	341	12	354
QSR70786.1	3.41e-50	66	341	4	283
QSR83320.1	3.41e-50	66	341	4	283

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003617_01476.