CAZyme Information: MGYG000003617_00318

Basic Information

• Species: Helicobacter_D sp900770765
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D sp900770765
• CAZyme ID: MGYG000003617_00318
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42511.36	9.1153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003617	1743156	MAG	Fiji	Oceania

• Gene Location: Start: 68112; End: 69260 Strand: -

Full Sequence      

MKAIITGGGTGGHLSVAKAFLDEFTNRGFKCVFIGSSGGQDKEYFKKDSSFLKAHFLKTQ
GVVNKKGFAFFTSIFKQFKAFLEALRILREFKPDFIISVGGYSAAPASFAAVFLRIPLII
HEQNAQIGRLNRVLKNKATIFFSSYLKESPVHFYPTRLEFFKKARVRDDIKKVLFMGGSQ
GAKAINSFCLSAAESLVRDGIFILHQCGKSDFLRVAREYLELPLKVGILKDGILQSDLEI
LQKDSNLALLDNLDSSDSSVDVLLFAFSDKMPEILSISDFAVCRAGASSLWELCAGGIPA
LFVPYPYAAGNHQYYNAKFLEDKGLGFICLEQDLFLEVLQKAIDFTKENIKEISQNLQKE
CAKDATKQMCNTILEKLQSKKG

Enzyme Prediction     

No EC number prediction in MGYG000003617_00318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	173	360	1.8e-38	0.9554140127388535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	5.37e-106	13	375	14	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.35e-91	13	371	12	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	8.11e-88	13	373	13	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	7.40e-81	13	375	13	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.75e-35	173	369	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOQ97432.1	1.24e-150	1	377	1	369
VEJ07833.1	1.84e-147	1	377	1	357
AWI34126.1	4.11e-136	1	377	1	357
QFR43912.1	1.12e-98	1	369	1	330
QDF29963.1	6.16e-98	1	373	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	9.83e-32	9	341	18	328	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	2.47e-30	2	373	8	350	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	9.15e-30	2	326	4	301	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MAD4	4.49e-98	1	374	1	335	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) OX=273121 GN=murG PE=3 SV=1
Q30PK0	1.59e-88	1	377	1	338	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=murG PE=3 SV=1
Q1CSB1	1.69e-88	1	374	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain HPAG1) OX=357544 GN=murG PE=3 SV=1
Q9ZK59	2.39e-88	1	374	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=murG PE=3 SV=1
O25770	3.38e-88	1	374	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003617_00318.