CAZyme Information: MGYG000003595_00715

Basic Information

• Species: HGM11525 sp900770405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11525; HGM11525 sp900770405
• CAZyme ID: MGYG000003595_00715
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722	MGYG000003595_127|CGC2	81754.48	4.9851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003595	2475226	MAG	Fiji	Oceania

• Gene Location: Start: 28869; End: 31037 Strand: +

Full Sequence      

MIGQAKWIRADIACPLFEKKIKLKHGVKSAVLQITARGIYECLINGVRVGDFVLAPGWTD
YNDHIQYQEYEVADMLDENSVISVKCGAGWAASKMGLDEYESVYTDHPSCIFSLDIEYEN
GEKESVVSDRSALVYTSDVVKTDIYHGETVDRTVEKAYRRNAEEESIAVKLVPQLGEPIK
EQEHILPAGIFKTPKGEVVVDFGQNMTGYVKVRVSGKKGDRIRISHAEVLDADGNFYNEN
MRGARCEALYIMGSEYEEFKPTFTFYGFRYIRLDEFPGTPQLDNFEAVEVHSDMRRTGSF
VCGHEGLNRLYSNIIWGQKDNFLDIPTDCPQRNERLGWTGDAQVFARTAAISFDVEKFFE
KWLCDMRAEQKPNGEIPAVIPDCIRRIPQPVSAAWADASVICPWEIYKAYGDSRILADNF
ECMRGWVEYMHNFGEEEYLWLGGGHFGDWLGLDSPPGSYKGSTDEDLIASCFFAYSTSLL
IKAGEILGRDMAEYKDMYKKIRSAVQAHFTEDGEPKCKTQTACVLLIKFGLCDDNRRAAD
LLTRLIRESGGHLTTGFVGTPYLLHALSETGNLKLAYDLLLREEYPSWLYTVNHGATTVW
EHWDGIKEDGSMWSADMNSFNHYAYGAVFDWIFGVCAGIKVSDDGAGYRKITIAPRPDAR
LGFADTAIDTRQGRVRVLWRYTENFIRYEIEIPSGTKAELTLPDLKKYRLGGGKYIFYTE
KV

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	190	702	6.4e-165	0.998015873015873
CBM67	12	154	4.6e-18	0.7556818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.39e-130	295	633	1	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.34e-35	27	183	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.94e-31	192	291	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.34e-18	641	717	2	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW80109.1	1.51e-254	1	720	1	734
QIB57111.1	1.51e-254	1	720	1	734
ANU76871.1	2.29e-253	5	720	5	734
ASU29674.1	2.29e-253	5	720	5	734
QQQ94449.1	2.29e-253	5	720	5	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	6.70e-148	27	703	316	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.27e-122	17	722	134	868	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	3.74e-121	15	722	177	944	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.70e-147	27	703	316	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	9.43e-146	15	703	174	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.37e-113	9	703	164	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.85e-75	13	702	183	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003595_00715.