CAZyme Information: MGYG000003594_01628

Basic Information

• Species: RUG12045 sp900770325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG12045; RUG12045 sp900770325
• CAZyme ID: MGYG000003594_01628
• CAZy Family: GT2
• CAZyme Description: Ubiquinone biosynthesis O-methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000003594_180|CGC1	35565.13	4.5622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003594	2830222	MAG	Fiji	Oceania

• Gene Location: Start: 5583; End: 6503 Strand: -

Full Sequence      

MQEQVGKVCLDDTWYPGEDLYSDGEIEDRLLEIAKNSSEEELNGVIEREKDWAVLYHMSH
IRENIVDWLPISKEDSVLEIGAGCGAITGALARKAGQVTCIDLSRKRSLVNAYRHREMDN
IRILMGNYQDIEKNLTEKFDYITLIGVFEYGQAYIGTDSPYEEFLRQIRPHLKPQGKVVI
AIENRLGLKYWAGCREDHTGNLFEGLENYPRPVGVRTFSRPELERLFDQTGFGKRQFYYP
YPDYKLPLAIYSDEYLPKAGELNTNIWNFDRERLVLFDEEKVFDSLIESGLFPQFSNSYL
VILERD

Enzyme Prediction     

No EC number prediction in MGYG000003594_01628.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02440	AdoMet_MTases	1.37e-14	77	183	2	105	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).
pfam13649	Methyltransf_25	1.27e-11	77	176	1	97	Methyltransferase domain. This family appears to be a methyltransferase domain.
pfam08242	Methyltransf_12	2.24e-10	78	178	1	98	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
TIGR02469	CbiT	3.18e-10	61	180	7	120	precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit. This model recognizes the CbiT methylase which is responsible, in part (along with CbiE), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiE subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
pfam13489	Methyltransf_23	6.31e-10	68	232	17	158	Methyltransferase domain. This family appears to be a methyltransferase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHC23007.2	1.50e-110	1	301	1	297
QNM10216.1	1.65e-75	14	301	8	290
QCU01345.1	9.10e-74	14	291	8	289
CBL21588.1	1.47e-73	14	291	8	289
AFZ48015.1	7.92e-54	21	306	35	335

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45438	8.36e-06	55	133	26	101	rRNA adenine N-6-methyltransferase OS=Bacillus licheniformis OX=1402 GN=ermK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003594_01628.