CAZyme Information: MGYG000003591_00127

Basic Information

• Species: CAG-177 sp900770255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp900770255
• CAZyme ID: MGYG000003591_00127
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000003591_12|CGC1	89532.26	4.8431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003591	1880790	MAG	Fiji	Oceania

• Gene Location: Start: 7025; End: 9487 Strand: -

Full Sequence      

MKHADLIAQMTLEEKVAFCSGSDYWHTAAIERLGIPSILWSDGPHGIRNSVGTKDKDDKD
KKAKGISLLGVPAICYPTAATTACSWDPDLIEGMGELLGEECVAEKVSVLLGPGTNMKRS
PLCGRNFEYFSEDPYLAGKMSAAFVNGVQSKGIGTSLKHYAVNNQETRRMTVSAVVDERT
LREIYLTAFEIAVKEAQPWTIMCMYNRLNGVYGAENKWLLTDVLRRDFGFEGMIVTDWGA
ENERVPGLLAGQNLEMPTSNGAGNKKIYNAVKSGEISEDFLNEMVDGVIDVIMRAKEVLK
DGAGYNTAEHHAAARKIAGECMVLLKNEDNILPLDKKAKVAVIGQMAKKPRYQGAGSSLV
NSIKLDSAFDTMFENGIDVIYADGYALTKKEKRTSTETYIADAVEAAKKADVAVLFLGLT
DEFESEGFDRTHLRIPPEHVALLSAVRGVTENVVVVLAGGAVVEMPWIGETKALLNSYLG
GEAGGSAVTDILFGDVNPSGKLAETYPFSLEDTPSYNNFPGNTATVEYREGIYIGYRYYD
TAKKDVLFPFGFGLSYTKFEYSDLKVSAKSIKDTDTVKVSFKVKNVGDRDGAEVAELYVA
QENSTIFRPVKELKGFKKVFLKAGEEKEIEIELGKRAFAFYDVDLGDWHVETDTYKLLVG
ASSRDIRLEGEVEVTSTVDAPVKDLRDVMPAYYSADIMNVPDDQFEALIGHAIPESEIKD
YPNLTLANTIEDAACGKNGAKLCKLLRKFVGTDGMACSIALQTPVKNFVSMSMGVFSEEL
AGQLLDILNDKKPMGRGILVLIGKAIPSVVKGLPALLNSI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	256	2.3e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.10e-99	4	667	39	758	beta-glucosidase BglX.
COG1472	BglX	3.10e-63	27	350	50	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.21e-58	6	631	56	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.93e-56	322	536	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.45e-31	32	291	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX02594.1	8.35e-277	6	789	8	755
ANW99954.1	3.37e-276	6	789	8	755
AGC67337.1	1.14e-275	6	789	43	790
AGI38398.1	1.14e-275	6	789	43	790
AUS96756.1	5.40e-271	6	791	8	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.41e-264	6	790	8	753	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.89e-216	7	666	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	2.41e-129	6	674	9	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X40_A	5.72e-128	5	674	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.65e-127	5	674	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.24e-264	6	790	8	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.52e-205	7	666	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.03e-205	7	666	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BA18	1.34e-135	14	677	24	832	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
A7LXS8	3.73e-134	5	667	48	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999940	0.000107	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003591_00127.