CAZyme Information: MGYG000003578_01066

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS2037
• CAZyme ID: MGYG000003578_01066
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000003578_279|CGC1	51787.18	4.8695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003578	3478423	MAG	Fiji	Oceania

• Gene Location: Start: 375; End: 1757 Strand: +

Full Sequence      

MRYIENKVENLKIAYIGGGSRGWAWGFMSDLAACDDISGTVALYDIDFQAAKDNEVIGNK
FKDAEGAKSIWDYQAVETIGEALTGADFVIISILPGTFDEMESDVHEPEKYGIYQPVGDT
SGPGGIIRAMRTVPMFEEIGENIKKYAPNAWVINYTNPMTLCVKTLYRVFPDIKAFGCCH
EVFGTQTFLAKMVKEMLGADTVERHEIKVNPVGINHFTWLTEATYHNIDLFPYYREFCQK
HKDGYEQVDFNWMNSVFASAEKVKMDLFLRFGYIAAAGDRHLAEFCEGKWYLASPDRVHE
MKFDLTPVSWRKKDLQERLEKSKRLRSGEESVKVSGTGEEGVNQIRALLGLTELITNVNI
PNMGQIPNLPTGAVVETNAIFRANSLTPVFAGAIPKEIYPMIVRICSEQELLSDGIAKRN
LDKIFAAFVNDPLVTCGMEDARRLFDSMCANTKEYLGMYE

Enzyme Prediction     

No EC number prediction in MGYG000003578_01066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	192	2.8e-55	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.41e-149	11	448	1	422	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	4.41e-103	11	456	4	436	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	5.20e-65	12	459	3	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	5.30e-57	12	195	1	183	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	3.02e-45	11	446	1	420	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNX53414.1	8.04e-204	1	456	1	458
QEH67112.1	4.62e-203	1	456	1	458
ADZ85649.1	5.35e-202	1	456	1	458
AFK85236.1	3.11e-199	1	456	1	458
ADL69889.1	1.79e-198	1	460	1	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	9.85e-154	8	446	3	433	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1U8X_X	1.87e-22	72	455	89	460	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	2.39e-20	5	455	1	438	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]
5C3M_A	4.44e-20	82	459	77	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	8.81e-18	82	459	80	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	6.22e-200	1	456	1	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.04e-173	1	456	1	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	2.50e-170	1	456	1	460	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	6.72e-158	8	448	7	439	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P30877	2.61e-38	12	456	6	445	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003578_01066.