CAZyme Information: MGYG000003573_00965

Basic Information

• Species: RC9 sp900769905
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769905
• CAZyme ID: MGYG000003573_00965
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000003573_127|CGC1	39368.04	4.5141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003573	2177308	MAG	Fiji	Oceania

• Gene Location: Start: 3214; End: 4272 Strand: +

Full Sequence      

MTICALLCSCAARELTPAEELAKRLGQHRDKSEILIGHQDDLLYGHSWKVSEDESLFGRS
DVRDVCGQYPMVLGVDLGGIELGAERNLDGNRFDQIRAAALKQVEHGGIVTVSWHIRNPL
TGGDSWDVSSKEAVKSVLEGGSRHELFLSWLDAAADYISGFRDADGKLIPIIFRPWHEHT
GSWFWWGEGLCSADEYKALWKLSYDYLSIERGLDNLLWSYSPGAGNLSAERIGERYPGDD
MVDILGLDAYQYGSSGDFRKEVLASASEIAAFAGERNKLYALTEIGYEGIPEEGWWTGVL
YPTLRELSPSPVYVLFWRNAWDKPGHFYVPFPGQASAEDFRSFADKDDIVLN

Enzyme Prediction     

EC	3.2.1.-	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	17	297	5.1e-61	0.8151815181518152

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.86e-34	60	277	43	260	Glycosyl hydrolase family 26.
COG4124	ManB2	1.89e-19	169	312	180	337	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX74202.1	3.33e-146	12	351	26	363
AIT97142.1	1.76e-128	4	347	14	357
ACA61146.1	1.13e-127	4	351	14	354
CAJ19136.1	4.11e-122	16	351	40	380
ADX05678.1	2.65e-117	6	351	15	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.59e-109	14	351	7	335	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	8.40e-77	34	351	57	387	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	8.40e-77	34	351	57	387	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	1.60e-76	34	351	80	410	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	6.63e-76	34	351	57	387	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.63e-45	27	352	66	408	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	7.73e-43	41	351	65	394	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	2.12e-24	39	321	55	328	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	1.12e-22	62	310	189	440	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	7.21e-21	45	292	49	304	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999947	0.000101	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003573_00965.