CAZyme Information: MGYG000003570_01774

Basic Information

• Species: Treponema_D sp900769985
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769985
• CAZyme ID: MGYG000003570_01774
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296		34206.95	6.825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003570	3193382	MAG	Fiji	Oceania

• Gene Location: Start: 3872; End: 4762 Strand: +

Full Sequence      

MPTKIIKYTGGLGNQMFQYAFAYVLEQKGFEVLADTKLYTKPCVRGGVDLSHGAFEVARV
FGLDIKEASDAQVKKLGDRAESFFERLRRKFFTKKTHIIEYDSKFHPEHLTDQRDLYLDG
YFQNPLYWQGYEEQIKNQFTFKLDLNEKSKELASALDSLKDKTCAIHVRRGDYLNHKTLF
VCDKPYFENAISKMLELVPQIQTFIIFSDDIDWCRKNIDTHGKEKIFVDWNSGKDSWQDI
ALMTNCANAIIPNSSFSFWGAWLNKNPDAVIVCPKIWSTSGSTDIIPDNWKTVSVE

Enzyme Prediction     

EC	2.4.1.69

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	5	291	1.4e-64	0.9818840579710145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.17e-55	4	278	2	256	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.95e-25	10	280	8	281	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL00982.1	5.17e-55	4	290	2	286
BCS84611.1	8.36e-54	4	290	2	287
AAZ28414.1	2.62e-53	4	293	2	290
ALJ45763.1	1.39e-52	4	296	2	292
QRQ57369.1	1.39e-52	4	296	2	292

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	7.30e-23	9	290	6	299	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
P19526	9.13e-13	108	263	152	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1
Q9TUD6	9.17e-13	108	263	153	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Pan troglodytes OX=9598 GN=FUT1 PE=3 SV=1
Q866E8	1.24e-12	116	263	163	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866F0	2.26e-12	116	263	163	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003570_01774.