CAZyme Information: MGYG000003550_02760

Basic Information

• Species: Clostridium sp900769625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900769625
• CAZyme ID: MGYG000003550_02760
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000003550_99|CGC1	54670.82	5.1703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003550	3104477	MAG	Fiji	Oceania

• Gene Location: Start: 6300; End: 7733 Strand: -

Full Sequence      

MSKGFSKDFLWGGAVAAHQVEGGWNKGGKGVSIADVLTAGAHGVDRIITDGVLEGYNYPN
HEAVDFYSRYKEDIALFAEMGFKCFRTSIAWTRIFPNGDDAEPNEEGLKFYDDMFDELLK
HNIEPVITLSHFEMPYNLVKKYGGWKSRKVIDFFVKYAETVMKRYKDKVKYWMTFNEINN
QKNYKYHLFGYTCSGVIFNKEENPEEVMYQVVHHELVASAKVVKLGHEINPDFQIGCMIA
YVPIYPYSCNPEDIMYAAEAMHDRHLFADVHARGAYPSYAKCEWERKGYNIHMEPEDEQI
LKEGIVDYIGLSYYMSNAVKADNVVEGSGLDGFPGSVPNPYVKASDWGWQIDPIGLRYGL
NNLYERYQKPLFIVENGFGAIDQLDENGVVQDDYRIEYLKSHIVQMKKAVELDGVELMGY
TPWGCIDCVSFTTGEMKKRYGFIYVDKDNEGNGTLNRSKKKSFDWYKNVIASNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	474	1.7e-153	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	4	477	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	5	477	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	7	477	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	3	476	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	477	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS19178.1	7.34e-308	7	477	6	476
AMC08922.1	8.55e-307	7	477	6	476
QUO31522.1	8.22e-296	9	477	9	477
ACQ93096.1	1.84e-292	1	477	1	477
AVF36972.1	1.24e-290	1	477	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.30e-266	7	477	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	2.15e-230	1	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.14e-230	1	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	2.83e-221	7	477	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	4.28e-204	3	477	9	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	7.10e-266	7	477	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.81e-240	7	477	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	8.29e-201	3	477	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	2.03e-185	5	477	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	2.14e-175	5	477	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003550_02760.