CAZyme Information: MGYG000003549_00798

Basic Information

• Species: UBA1259 sp900769565
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp900769565
• CAZyme ID: MGYG000003549_00798
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		40753.21	5.0924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003549	1484614	MAG	Fiji	Oceania

• Gene Location: Start: 43898; End: 44965 Strand: +

Full Sequence      

MAIRKLIVSKDDSIYEAWPDLAMTESGKLIVVFSECEHHMDRNHARIVLKESFDKGETWG
EKIFLTERCEGVDFSQDDCKPYYNCARIGRFKNGNMYVIADKIFARRERKAEIYLWIGDK
EGNNWGEKIKLPLNGIVPDKITELDSGRIIVSAHFENPNTEKLEQYLIYSDDGMKTWSER
ITVAAHPDLNLCEVSILQHEGALVAFLRENSRLGYPILKVISYDDGLTWSGIYHTAMDSG
HRPVSGKLQNGRVMVTYRYIPLGTNNVFVGLLRSEDLLKTSRQEQGVTIMPLDYDRNQSP
DLGYTGWVQFDDGEIFVVNYIKDDSDKAYIRGYKFRMEDVELPVTETATAKVENF

Enzyme Prediction     

No EC number prediction in MGYG000003549_00798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	18	233	3.3e-22	0.6491228070175439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.62e-20	19	235	17	243	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.02e-08	121	257	90	227	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.96e-05	169	276	51	181	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	0.006	24	215	153	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB46154.1	1.37e-114	1	342	1	342
ANY72719.1	1.42e-114	1	342	1	342
AVM44758.1	5.44e-96	3	342	2	345
AHF91127.1	6.02e-94	3	344	2	359
AHF89372.1	3.35e-60	3	352	2	363

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003549_00798.