CAZyme Information: MGYG000003542_01623

Basic Information

• Species: Alistipes sp900769445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769445
• CAZyme ID: MGYG000003542_01623
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		41610.57	4.267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003542	1966624	MAG	Fiji	Oceania

• Gene Location: Start: 11554; End: 12672 Strand: -

Full Sequence      

MLLMFVLTADVVLAQQNLWQSAGVTSPEVCADGSVVFRYFAPEAESVAVVGDFASEAQSM
SKSESGVWELHTAPLASEYYTYTFTVDGNTGIIDRENVYTVRDVGSLMNYFIVGGGCGDL
YKAQDVPHGAVSRVWTATEGASRRMTIYTPAGYEAGYRNYPVLYLLHGMGGDEEAWVATG
RVAEVMDNLIAEGRVEPMIVVMPNGCMRHDAAPGYSDEGFYKPYMSGSMDGSFEEYFDDV
VAWTDAHYRTYATKERRAIAGLSMGGFHAMQISKRYPDMFDYVGLFSAAIYRGEESVPMY
ENLESGIAEQFAKGVSLYWIAIGADDFLYEENVRFRAMLDAEGYEYEYYESAGGHTWRNW
RQYLALFAERLF

Enzyme Prediction     

No EC number prediction in MGYG000003542_01623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	138	365	1.5e-57	0.9427312775330396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	5.30e-27	125	372	63	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	1.01e-25	33	114	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	5.29e-21	143	365	6	240	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	3.86e-16	128	371	16	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	1.64e-12	127	295	7	177	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH98968.1	4.82e-132	2	372	7	396
QUT21362.1	4.82e-132	2	372	7	396
QJE29438.1	4.82e-132	2	372	7	396
AST55403.1	4.82e-132	2	372	7	396
QIX64683.1	9.68e-132	2	372	7	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	5.40e-90	22	372	20	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.53e-55	23	372	36	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	5.06e-40	27	372	17	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	5.17e-40	27	372	17	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	1.59e-38	23	372	38	381	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.09e-36	9	372	314	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	7.19e-35	28	372	42	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	8.54e-32	17	372	385	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	5.80e-25	126	361	46	266	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM38	6.52e-13	101	309	143	342	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001156	0.997916	0.000213	0.000266	0.000218	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003542_01623.