CAZyme Information: MGYG000003535_01164

Basic Information

• Species: Prevotella sp004556065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp004556065
• CAZyme ID: MGYG000003535_01164
• CAZy Family: GH139
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
969	MGYG000003535_46|CGC2	110132.43	6.8619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003535	2652504	MAG	Fiji	Oceania

• Gene Location: Start: 14969; End: 17878 Strand: +

Full Sequence      

MRHNVILSAILLMFSLLATAAKDYTPEPYTWTTQSDNSSGSMPCGGHDIGMNVWVERGDL
LVYLSRSGFFDEHNTLLKAGRLRLRLEPKDATGTSVFDGEDFRQTLSLDDGAVYVRGGGV
TVRLWADVHEPKVFVEIKSAKPVKATLAYESWRHKDRPVPREAVQQFTWKWLSKGGHITY
ADSIRPGKSSIIFEHHNRKETVYDYTVSYEKLDAVKHNINNPIGDLSFGGRMSAPTFTYT
GTTDGVYASTDYRAWNYVSPSLTRSTITVELAVNKGPLQLPGKSVTADASKRRSSQWWHA
FWQRSYIKSAHPDAARIARNYELFRYMLGCNAYGQWPTKFNGGLFTFDPVYARAGSPFTP
DFRCWGGGTMTAQNQRLVYWPMLKSGDTDMMRSQFDTYLYMLPGAKARTQHYWGHGGACF
EEQIENFGLPNPAEYGNHKPGQDPSWMKNSWLEYQYDTVLEFCQMILMANEYAGMDITPY
RELITESVRFFDEHYQYLARQRGTKPLTEDGKLVVYPSSGCETYKMAYNPSSVIAALKAV
VATLERHGGLAAWGLDSAFAQRIPDIPTRTMENLLCIAPAVTWMRINNVESPQLYPVFPW
RIYGLGRPDIDVALNTYFKDDYVQKMRSSAGWKQDNIWAATLGVLPDAVRLCKEKFADGP
YRFPAFWEIGFDWAPDHNRGGSAMIGLQEMLLQEKPDGELMLFPCWPKEWDAEFRLHATG
GRTVDARIANGAVTATSTVTDGRGRTTTTDIPAPLRVTIFGDSYSTFEGYLTPSTNEPWY
YWPGSPARTEGNDVCHPAQTWWWQVVRRLGARLETNNSYSGSTIGYTGYVIPETGKHDDY
KPRSFITRLPDLGNPDLILICAGTNDSWDGEDIGEYKYEGWTETDLYTFRPAMAKFCSEL
KRLYPDKQVLFIINSELKPDFVESMKVIMERYGVEWLQLKNIDKQYGHPSVKGMRAFADQ
VCDYLQNKR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH139	9	739	1.3e-273	0.9652509652509652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18961	DUF5703_N	1.42e-124	30	307	1	287	Domain of unknown function (DUF5703). This is an N-terminal domain of unknown function mostly found in bacteria. It is possible that this domain might be a putative glycoside hydrolase. This family belongs to the Galactose Mutarotase-like superfamily.
pfam16255	Lipase_GDSL_lke	6.25e-72	756	965	2	202	GDSL-like Lipase/Acylhydrolase.
pfam13472	Lipase_GDSL_2	3.99e-07	759	956	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01831	Endoglucanase_E_like	5.66e-07	756	960	1	163	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
cd00229	SGNH_hydrolase	6.96e-07	757	964	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII68825.1	4.17e-275	26	733	22	722
QJR59441.1	4.17e-275	26	733	22	722
QJR55760.1	4.17e-275	26	733	22	722
QJR76304.1	4.17e-275	26	733	22	722
AII62840.1	4.17e-275	26	733	22	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M8K_A	6.19e-62	756	961	22	218	Crystalstructure of a putative GDSL-like lipase (BACUNI_00748) from Bacteroides uniformis ATCC 8492 at 1.90 A resolution [Bacteroides uniformis ATCC 8492],4M8K_B Crystal structure of a putative GDSL-like lipase (BACUNI_00748) from Bacteroides uniformis ATCC 8492 at 1.90 A resolution [Bacteroides uniformis ATCC 8492]
4NRD_A	1.81e-58	757	969	25	227	Crystalstructure of a putative GDSL-like lipase (BACOVA_04955) from Bacteroides ovatus ATCC 8483 at 2.10 A resolution [Bacteroides ovatus ATCC 8483],4NRD_B Crystal structure of a putative GDSL-like lipase (BACOVA_04955) from Bacteroides ovatus ATCC 8483 at 2.10 A resolution [Bacteroides ovatus ATCC 8483],4NRD_C Crystal structure of a putative GDSL-like lipase (BACOVA_04955) from Bacteroides ovatus ATCC 8483 at 2.10 A resolution [Bacteroides ovatus ATCC 8483],4NRD_D Crystal structure of a putative GDSL-like lipase (BACOVA_04955) from Bacteroides ovatus ATCC 8483 at 2.10 A resolution [Bacteroides ovatus ATCC 8483],4NRD_E Crystal structure of a putative GDSL-like lipase (BACOVA_04955) from Bacteroides ovatus ATCC 8483 at 2.10 A resolution [Bacteroides ovatus ATCC 8483],4NRD_F Crystal structure of a putative GDSL-like lipase (BACOVA_04955) from Bacteroides ovatus ATCC 8483 at 2.10 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000206	0.999187	0.000149	0.000162	0.000138	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003535_01164.