CAZyme Information: MGYG000003533_02029

Basic Information

• Species: SFTJ01 sp900769345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp900769345
• CAZyme ID: MGYG000003533_02029
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000003533_164|CGC2	82708.85	6.5558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003533	2902010	MAG	Fiji	Oceania

• Gene Location: Start: 46617; End: 48866 Strand: +

Full Sequence      

MNRTLCVTIACFMALSMYAKKIAIYKDAKQPIEKRVDDLLSRMTVEEKVMQLCCWYMAEG
SEIYRSSPEHSMQDIEDNITKGYGSVSTPARNLYAEQSAEMINKMQKIAVTKTRLGIPVL
VGDEALHGIDVKGACCFPQPIGIASTWDIDLMQRVATAIGKEAFSTGVRQVMSPVLDLGR
EPRHGRFYETFGEDPLLVSLMGGTFVSEVQRHGVVCTPKHFVANFVGEAGREGANMEISE
RALRESHFVPYEYAVRQCGALGIMTAYNAVDGVPCAINKWLMQDILRDEWGFRGIVVSDW
SSVPHLKNFHHCIDSLQQGAVLALRAGMDVDLPHGESFIALTQAVKEGHLSESELDVNVG
RVLWLKFHLGLFDNPYIDTKVGKELRDCAEHRQLARQMARESIVLLKNDGILPISNNVKR
IAVLGPNAAEVRLGGYTANGVDAISPLDGLRNILGDKVELVYQKGAGIFNSKPEEVEQAI
EAVKTCDMAILFMGGDGNNSGQGTGGETVDRTDLRLMGKQEELINKVAATGKPIVVVLVD
GRPVVVKPWLDKVNGLVMMWYAGEEGGNAIAEVLSGDFNPSGKLPCTFPMTTGQCPLYYS
CYPMGRASRSAELNVPYDNYRYNPQFPFGFGLSYTTYKYDNATVVNNNSTSPVIKVEVTN
SGSRAGSEVVQLYLASKTHRVVRRVKELKAFRRIHLKPGETKTVEFTLADTDFMFLNKKL
QKEVDEGTYEVTIGPDSMNGISTTFNVKK

Enzyme Prediction     

No EC number prediction in MGYG000003533_02029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	333	4.8e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.52e-172	1	746	1	763	beta-glucosidase BglX.
COG1472	BglX	4.01e-97	43	459	1	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.77e-73	44	363	1	314	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.05e-72	85	734	48	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.38e-68	403	634	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW11229.1	6.13e-241	30	747	7	730
AOW11231.1	1.68e-231	13	747	1	743
AOW11394.1	1.13e-221	43	747	1	713
ACK42995.1	4.75e-209	29	737	3	744
ACI20082.1	6.92e-206	29	737	3	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	5.90e-129	25	739	36	776	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	6.75e-123	30	748	8	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.68e-122	30	748	8	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	4.50e-121	25	737	7	745	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.44e-120	25	737	7	745	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.52e-137	100	737	48	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	8.01e-127	36	737	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.52e-122	36	737	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	5.79e-119	25	749	29	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	1.16e-99	114	737	34	657	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.014027	0.983846	0.000886	0.000490	0.000348	0.000376

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003533_02029.