CAZyme Information: MGYG000003533_02005

Basic Information

• Species: SFTJ01 sp900769345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp900769345
• CAZyme ID: MGYG000003533_02005
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000003533_164|CGC1	28819.29	7.698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003533	2902010	MAG	Fiji	Oceania

• Gene Location: Start: 10544; End: 11314 Strand: -

Full Sequence      

MKYVITLIMAVALSVAAMAQEKYEKCELINDGDTLRYCALAPQQVKPGEKYPLVVFLHGA
GERGEDNQAQLFHGSQQFLNPVNREKYPCYVVFPQCPSGKYGAYIDRPLSLVPQEMPIQE
QPSAFIRGVHALIMKYLAEQNVDPKRVYIMGLSMGAMSTYDMVIRYPELFAAAVPICGTV
NPLRITPAVKHTKWSIYHGDADTTVPLDGSREAYRKLRSVGAEVKYTEFPGVEHGSWNPA
FSMPDFMSWLFAQRRN

Enzyme Prediction     

No EC number prediction in MGYG000003533_02005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	35	236	9.7e-28	0.8810572687224669

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	6.41e-44	32	255	171	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	2.16e-14	30	235	373	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG3509	LpqC	1.45e-12	1	226	8	230	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG0400	YpfH	1.45e-11	46	231	13	186	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	4.63e-10	52	238	15	203	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	6.27e-41	37	254	827	1042
ABS60377.1	3.40e-40	44	255	30	245
QDU56037.1	1.74e-33	49	255	817	1007
ACR12533.1	5.35e-24	34	239	63	270
QEY17854.1	5.74e-23	20	255	781	1041

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	3.73e-45	32	255	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	1.02e-23	28	255	14	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	4.56e-11	49	255	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0J968	1.49e-07	51	234	9	199	Probable carboxylesterase Os04g0669600 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0669600 PE=2 SV=1
P52090	3.92e-07	52	217	66	247	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1
Q9HGR3	7.59e-06	46	181	43	164	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999193	0.000150	0.000142	0.000135	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003533_02005.