CAZyme Information: MGYG000003528_02745

Basic Information

• Species: CAAGGB01 sp900769285
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; CAAGGB01; CAAGGB01 sp900769285
• CAZyme ID: MGYG000003528_02745
• CAZy Family: PL33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
969	MGYG000003528_346|CGC1	106612.38	6.9527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003528	3662993	MAG	Fiji	Oceania

• Gene Location: Start: 6309; End: 9218 Strand: +

Full Sequence      

MNHQPHLPALALLLAGASLSAATLIDVPNLDFEQGLAHWSSGNAMATAEPRAARSGKLGL
VIRDDSPTAGSDLFSRPFPVRQGTTYRLTFWARKLQETSQGTAVYIRYFDANGKMLHDRQ
SGETVLPMEPSSSWHENRLHFRPSNPAIASARIWVHSVNGAISLDALDDFRLEELTADEA
KGVALTTLTGLPPLSQQRVAEIAALLNDEPRGLGFPVTRRDKWDHLPNTTGQDTLIAQAE
KFAATEPPELRDEDYLLFNKTGNRTIYEKPYFERRGRLYTLAVAEALENHGRFLPALERD
IAAILAERSWVLPAHDASLSNFHQKKFYVDLFSSERASDLATVDYWFQDSLKPETRAAIR
REAHRRVIDPYLRSVHGQDMTGHSWMNATHNWNAVCTGNLINCILTLVPDKTVRAEAIAT
AERSNQRFLAGFTPDGYCSEGIGYWHYGFGHFLIMGEHVLQETNGRLSLFNHPNLPLIAG
FATRIQLSEGIAPAFADCGVNASLSDHYALLIARHWPEALNRRPVPASVLRSAFPIMPLI
AFDDAAKLNPQLPEKATFPLRSAFPDAGIHLLRSTTAKGIPFGIAIKGGHNAEHHNHNDV
GSFLVASGASRLLIDPGAETYTRQTFSNLRYTFNLLNSFGHSVPVVAGKLQRPGRNARGT
FTHTSFSDQRDELTLDLAAAYDVPELTALTRTVVLDRAAETITITDRVAFSSPQTFSSAL
ISGAAVASPEPQRLIVSDSRQALDIAVAVDGGPWTAKTERVIRQFDRPGPNRFSVTLDQP
VTEAAITFTIRPSDIPHELLSGYRQPDLKALGLAPRPQDAITIQAEDFTGQTLPKPVEGD
APSRGVAVESKPGAEGKAFKLWDREGHALAWTFEVPKAGRYLLQARACCDHLEGATRLVS
LDGAKSQRTAFPNTFGWSSAKDDWQNVYPALKGRPIILTLTPGTHTLTLTNDCGRGLNLD
WLRLVPCDN

Enzyme Prediction     

No EC number prediction in MGYG000003528_02745.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL33	583	724	4e-49	0.9470198675496688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	4.35e-11	821	965	3	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd04083	CBM35_Lmo2446-like	1.84e-08	865	962	35	123	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam07940	Hepar_II_III	4.60e-08	559	709	4	151	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
cd02795	CBM6-CBM35-CBM36_like	1.35e-07	822	964	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.
cd14489	CBM_SBP_bac_1_like	4.35e-06	862	954	48	139	Putative Carbohydrate Binding Module (CBM) of extracellular solute-binding protein family 1. Domains in this family co-occur with extracellular solute-binding domains which are periplasmic components of ABC-type sugar transport systems involved in carbohydrate transport and metabolism. Carbohydrate binding modules of family 6 (CBM6), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36) are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of co-occuring (catalytic) modules to their insoluble substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV73410.1	3.40e-148	197	792	58	658
AKJ64649.1	1.55e-131	172	925	13	766
AOS44337.1	3.27e-131	184	792	7	627
QDT68999.1	7.89e-123	214	792	32	614
AHF91451.1	6.59e-112	190	793	35	671

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000515	0.998739	0.000225	0.000172	0.000168	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003528_02745.