CAZyme Information: MGYG000003525_00889

Basic Information

• Species: RC9 sp004556005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp004556005
• CAZyme ID: MGYG000003525_00889
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000003525_19|CGC1	43487.23	7.5415

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003525	2213098	MAG	Fiji	Oceania

• Gene Location: Start: 9634; End: 10800 Strand: -

Full Sequence      

MRYYLIAGEASGDLHGSNLIKGLLSEDPQSRFRFFGGEKMLQASAGRGELVRHYKDGAVM
GLGDVLGKAGYLLRKLSDCKADILSYNPDVVILVDYPGFNMKIARFCHKRGIRVFYYIAP
KTWASRAGRNRQLKKYVDKLYIIFPFECNYFEAHKIPYVYLGNPLLDAIRNCPAIGESQE
EFRGRCGLDGRDYVAILAGSRSGEIRRMMPVCTELVERLSRREDCADLQYVIAAAPSVDI
EVYRKLVPPGLADRVKVVQGETYPVLSHARAAIVNSGTASLETAIIGTPQVVCWSTGAFT
AWIARHVLHVMDHIKYVSLGNLCIDKLAFRELIQEDFNVDELEKEVLRLLFDEEYRDSMI
CDYGDICTVLGGDGASNKIAKSMIQNIL

Enzyme Prediction     

No EC number prediction in MGYG000003525_00889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	366	1.6e-99	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.14e-96	1	386	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.64e-91	1	385	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.21e-65	4	335	2	324	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.13e-57	5	385	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.17e-43	1	345	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53532.1	2.66e-111	1	387	1	370
BBL11605.1	5.52e-105	1	387	1	373
BBL08813.1	5.52e-105	1	387	1	373
BBL00808.1	7.81e-105	1	387	1	373
BAX81022.1	7.82e-104	1	387	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.89e-34	5	359	11	354	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.89e-34	5	359	11	354	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	6.43e-67	2	385	8	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	9.82e-62	5	380	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.42e-61	2	385	8	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.91e-57	2	387	8	380	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
B6J161	1.73e-56	5	388	8	374	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003525_00889.