CAZyme Information: MGYG000003524_01100

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177
• CAZyme ID: MGYG000003524_01100
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711		79579.17	5.1572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003524	1517347	MAG	Fiji	Oceania

• Gene Location: Start: 1523; End: 3658 Strand: -

Full Sequence      

MFKGAKWIECAASSESPIFRKTFNAEKGEKARIIICGLGFFKLFINGKKVSDDLLVPNAT
DYSERDLTKLYYKITDKLSHRIYCMEYDISDYLIQGENTLAVMLGNGYYNQHSRHAEGGV
VFGTPKLCYIIEKDSGTVLCDASTLSHTGFVTENNLYNGEKHDYTLCPTNGDFAESREIP
APESEFYIQTSPADKVIRSIEPKLICTVDGADLYDAGENTVGYAVFKGGEKGNKITVNYA
EVLDSSPKKYGIHFEEGYQQDEFICGGEETEYIPHFTWHGFRYFKVKGAKPIRVDVVHSD
CPVTSSFECDNSVLNWLYSAYIRTQLCNMHSGVPSDCPHRERLGYTGDGQLCCEAAMMML
DSREFYRKWLYDISDCQCKISGHIQHTAPLMGGGGGPSGWGGAIVEVPMKFYKTYGDIDL
LNEFFPKMLRFLDYLESRSENGLVCREEEGGWCLGDWCTPDEIKIPESYVNTCLYVRFMQ
QALEAAEILGRQSETAHLIDRIEKVKRAIDVAYFSPFSHTYIGDIQGASCLALRIGLGDD
KTLKVITEKYKKLGTFDTGIIATEALIGVLFENGENQLAFNLLSNKGENSFGKEAANGAT
TLWEYWSGIESQNHPMFGAATKYLFMYLLGIRQPDGEAGYKKAVISPRFVDGLSRAKGHI
TTENGIISVEYVKDEKSATVKVFADPKIEAVFEHNGIKTPFSGEKVFNIEI

Enzyme Prediction     

No EC number prediction in MGYG000003524_01100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	208	682	1e-115	0.9662698412698413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.16e-73	304	628	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.14e-26	29	198	4	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.76e-15	205	296	1	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.005	630	682	1	51	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	9.69e-226	2	711	3	726
QOY86540.1	1.10e-142	5	674	132	822
BCJ98018.1	1.28e-139	7	678	127	843
QUT50058.1	6.72e-126	5	658	142	822
AWY99317.1	3.23e-103	5	676	129	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.13e-74	16	682	176	886	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.13e-60	26	671	314	971	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.80e-44	13	674	127	819	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.16e-68	19	675	187	887	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.12e-59	26	671	314	971	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.52e-50	5	693	151	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.86e-49	4	692	152	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003524_01100.