CAZyme Information: MGYG000003523_00035

Basic Information

• Species: CAG-475 sp900769205
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-475; CAG-475 sp900769205
• CAZyme ID: MGYG000003523_00035
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		33246.11	8.3305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003523	1093650	MAG	Fiji	Oceania

• Gene Location: Start: 44; End: 916 Strand: +

Full Sequence      

MRISAKNRKYFVNCGQSYGEWAEPNDVCAFQWYDFAAPHPEESTAYTYFTLKRVLEVADI
LGRTDDKRLEKIKEYSQGAMSAYRELVTKKKFSLDTDRQAKLVRPLYMRLLDEKQTAFAK
ERLIKALDNYGWRLGTGFLSTPHILDVLCDIDVEYAYKLLENEELPGWLFMPKHGATTVW
EAWEGNSTQDKGIASLNHYSKGAMCEWLMRGMCGIKVDGKNRFVIFPKVGGKETFAKASY
KSVYGKVSSGWEKKDCKTIYTFEIPCNTTAKIVLPDGEREVGAGRYVFEI

Enzyme Prediction     

No EC number prediction in MGYG000003523_00035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	12	274	3e-53	0.5099206349206349

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.41e-37	18	212	150	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.09e-15	222	284	11	73	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25263.1	2.27e-119	1	289	558	845
QFJ55302.1	3.07e-103	1	286	573	861
QUC03017.1	2.53e-102	3	288	597	880
AWI66986.1	1.56e-98	3	290	575	861
ADP81465.1	1.44e-56	9	288	591	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	7.38e-30	1	275	727	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.03e-29	1	275	727	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.94e-25	9	280	609	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	5.65e-21	110	275	707	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003523_00035.