CAZyme Information: MGYG000003513_01460

Basic Information

• Species: Prevotella sp900769055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769055
• CAZyme ID: MGYG000003513_01460
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534	MGYG000003513_206|CGC1	59556.59	4.684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003513	2720584	MAG	Fiji	Oceania

• Gene Location: Start: 12801; End: 14405 Strand: -

Full Sequence      

MFYSHHVKGSHGFGGIWGSNYSTYHHNLIAHHSSRNPRIASNCGYMDYRNNVVYNWGYNS
CYGGEAHDPYNPSDTDGSYINMVNNYYKPGPATQPGQVSYRIANPGYRDIYSDYGKWYVN
GNYMEGNASVTADNWNGGIQTDGPLDMLRATSPWDAMPIEQQTAEEAYELVLSNAGATYP
KRDAIDRRIAEETRGGYATYEGVEYKNLKNVADVTKKCGIIDSQEDVGGWPELQSATAPA
DTDFDGMPDEWETKHGLNPNDPDDRNKKHTSGYTALEIYLNEMCGETVEGEFVTAQEPEG
ATASVYWRLESDNQAQVEGEIIALEEVFLGTTLDRYTAPNSYNTVWPEYTGWDTTRKTQR
VGITGGAWPGDDGYVADRYIQFGVKAKEDTSLFLEKLTFFLCGCGTNGMQCDVFYDTTTD
FSRPVHIGDFSAKGALPNSVMHAVSASPGLNMNGGDEFFIRVYPWSRSAMNNKTICISDV
NIIAKLTSQTGIEDVKAGRYDRVIYSADGLRRNREQHGLNIIRTADNRVVKVMM

Enzyme Prediction     

No EC number prediction in MGYG000003513_01460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	3	87	5.8e-24	0.4098360655737705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	0.005	241	262	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEG34169.1	3.07e-124	1	283	182	466
AUS04449.1	3.34e-122	1	281	177	459
QQY83656.1	1.33e-121	1	281	177	459
AEL26629.1	9.23e-119	1	283	177	460
AKP52261.1	7.35e-118	1	283	177	460

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CLG7	5.83e-18	27	283	196	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
A1DPF0	1.41e-17	27	287	197	418	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q4WL88	3.36e-17	27	287	197	418	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	4.50e-17	27	287	197	418	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
B8NQQ7	7.98e-17	27	283	196	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999215	0.000832	0.000008	0.000002	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003513_01460.