CAZyme Information: MGYG000003512_01601

Basic Information

• Species: UBA11524 sp900769075
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp900769075
• CAZyme ID: MGYG000003512_01601
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000003512_72|CGC1	40726.52	6.0431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003512	2777574	MAG	Fiji	Oceania

• Gene Location: Start: 17790; End: 18854 Strand: +

Full Sequence      

MDFKQIADKVLGMLQRADGNDPSRGHLTMNNWEWPTGVALYGIYKTYQQSGDKAILDYLI
GWYDDMLHREQQPHRNVNTVAPVLTLTCLYDETKNPEYLAHIESWAKWVLEEMPRTEYGG
LQHCTVWNKHYQQLWCDTLFMVCLFLAKAGVVLNRPAWIDEAEYQFLMHIRYLQDKVTGL
FYHGWTFDRRNNYANAKWARGNAWFTAAAIELKDITGRDNAAMRMILSAWEDQVLALWKY
QRVNGSFTTLIDVEETYCETSATAAIAYGVMKGLRMGVLKEARYFEMAQLAAKSVLDQID
ETGAVQGVSGGTGMGYNLQHYKDIIVTPTAYGQGLTFLMLTELMRKGEFEFFRA

Enzyme Prediction     

No EC number prediction in MGYG000003512_01601.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	345	2e-94	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.18e-89	28	346	30	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.55e-84	20	345	14	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE73111.1	3.73e-225	3	344	5	346
QTE72125.1	5.29e-225	3	344	5	346
QTE67501.1	3.16e-221	1	344	1	344
AGC68046.1	5.98e-143	1	344	5	346
ANX00975.1	5.98e-143	1	344	5	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.43e-89	32	345	65	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.69e-85	32	346	66	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	5.20e-82	30	346	45	371	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	3.71e-21	30	298	21	301	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.20e-15	5	334	50	401	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	7.17e-45	32	345	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	7.21e-07	145	331	5	205	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	7.21e-07	145	331	5	205	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003512_01601.