CAZyme Information: MGYG000003512_01599

Basic Information

• Species: UBA11524 sp900769075
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp900769075
• CAZyme ID: MGYG000003512_01599
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1084	MGYG000003512_72|CGC1	120309.94	5.0381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003512	2777574	MAG	Fiji	Oceania

• Gene Location: Start: 13789; End: 17043 Strand: +

Full Sequence      

MTNTYAFHHGWKFRLANRFPMAEALSAFRDAQRRDVYAPDYCDEDWETVTLPHTFNDGEL
FSVPIEDAGSGQTRTAAFYRNVLTVPAQHRQDRCILSFEGMRQTCYLYVNGQLAGYYEAG
VGPFGFDITPFLAPDGRNSITVLTDNTSTRNIPFCIAETPNKPDVIPGSYLFPQDQPVPA
DREGVGFFWNCNDFNPVLGGISQPVRVHFKPDVHLTLPLYANLQTHGTYVYATYFDLPTG
SMTLHVDAEVRSFRTEPVDAQVRVVLRTLEGEAVAAFTTEAEVIHPAPAEARIHRVSITP
EDAYVWDEATQHYIPAPEDEVAPTKLDAVGTQVIHAGTRVSGVTFWSLHDPALYRVEVTL
LVNGCETDQEVIETGFRKVGYDKDRGVTLGDQPVWLRGYAQRATNEWAAAGIVPEWMHDL
DALLIRESGANHIRFMHVAGSPADVRAYDRHGIVCTQPAGDKERENFGRQWDQRVELMRN
VILAYRNHPSILFWEAGNNAISAAHMAEMKRLKDALDPHGGRFMGCRTINTEDVLVHSEY
VGTMLNRHAGRFLSEHGPITETEYSREEAPRRVWDDFTPPDFDYRCKWLGKAGKKEKGRD
FYDLTSEDLALANARGYAEFFNDRLSGASGKQLYSAAAALCWTDSAQHGRQSWSENGRMS
GRVDAIRVKKQSFDVFRTMQTTRPAVKILGHWNYPPLTEDSYRYHDKAFNGRFWEETETL
LQRDPLHKTVYVIASYPVARVTLFVNGSPVGSCDQPENTFVFPIPDVDVTAGGCAEAVGY
GYDGQEVCRDRIETAGDPAEIRLTMRTSPEGLHADGNDLACVDVEVLDAQGRICPLCDAK
ITFRITGDAVFLGGYNSGRFNGNGRSDNVIHQDHVYAECGVNRVLLRAGQTPGEITLTAA
SAGLPDAAITLRSIPADTSALTAPTMSALYSNPPALFDPAEEFFAPIPAADAVKYTPETE
CYCKIMVNGQEPDFRGVRAVNRNGAIWGNVLCILERMKATDPARMDFTWDAENQRLTLLS
GGHTIIAQAGVTHLLVDGAENLMDGQPYVTDTGILVMEVNAIAPHVDGASAQFDDRIGAL
RIVM

Enzyme Prediction     

No EC number prediction in MGYG000003512_01599.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	658	8.6e-64	0.586436170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18565	Glyco_hydro2_C5	3.91e-21	803	910	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
COG3250	LacZ	1.84e-19	45	535	41	442	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	8.36e-11	38	518	55	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	2.45e-09	77	568	67	491	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	4.37e-09	38	211	15	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH35456.1	0.0	5	1082	19	1095
ASA20342.1	0.0	5	1082	11	1086
AGT88372.1	2.22e-183	38	913	21	791
ADJ49535.1	2.22e-183	38	913	21	791
QMV17606.1	3.01e-154	7	913	52	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.59e-127	4	932	37	823	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	6.06e-33	7	911	6	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	6.78e-31	7	904	12	798	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CUC_A	6.73e-24	7	853	18	784	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
4CU6_A	8.87e-24	7	853	18	784	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	7.08e-127	4	932	28	814	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	7.86e-25	7	909	47	844	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KPJ7	1.14e-15	43	498	76	429	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
A1JTC4	4.04e-13	61	518	113	496	Beta-galactosidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=lacZ PE=3 SV=1
Q56307	4.17e-11	35	500	60	442	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003512_01599.