CAZyme Information: MGYG000003501_00527

Basic Information

• Species: UBA7001 sp900768805
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UBA7001; UBA7001 sp900768805
• CAZyme ID: MGYG000003501_00527
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		62613.58	9.615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003501	2158154	MAG	Fiji	Oceania

• Gene Location: Start: 11319; End: 12944 Strand: +

Full Sequence      

MKLKNILKVLIYSITMVCTIAYICYRITFTIPTKLGILTLIISLFILFIEIWEAFDFFIY
FLNTLTSSRKSPKVPDISDIKDFPDIDVLIATYNESSELLIQTITACKNMNYPDKNKVHI
YLCDDGNRLEIKELAKKMEINYLTRSTNKNSKAGNYNHALKHLSSPYIATFDADMCPGEN
FLLTTLPFFLKSKEKIGFVQLPQSFKNPDIYQYRFNLENQIPFEQEYFYHNLQIAKNSIN
APVYCGTNTLISREALDATNGFATGTISEDIATGMLIQSKGYKCLAIDNIEAYGTSVNDY
EGFIKQRSRWARGCVQMLKKYKILGIKGLSIRQKLEYLACVSYWFFGFRRLVYLITPLLF
SILGIIIIDCDFKTFLLMWLPQYILKRLVLDKLEGNKRSSTWTKIYETILAPSLGTSVVK
EYLGSNNTKFEVTPKVELKAGMSKTNAKGLRWHLVLLALNIIGFILCLFKFEPEFYYNYI
LSFVWTISNIFYLTIAVIFDTKTAVREYEGFVPNKIKKYSKKALILLFFNRRGKKSWKKE
I

Enzyme Prediction     

No EC number prediction in MGYG000003501_00527.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	87	257	2.6e-28	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	4.79e-98	10	497	59	560	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
cd06421	CESA_CelA_like	1.87e-93	84	318	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.15e-68	6	497	188	673	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	3.79e-42	27	368	1	338	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	2.84e-27	93	321	7	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK79528.1	4.86e-137	84	499	83	496
AWV81228.1	4.86e-137	84	499	83	496
ADZ20613.1	4.86e-137	84	499	83	496
AEI33806.1	4.86e-137	84	499	83	496
QLG36835.1	3.61e-127	84	499	81	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.54e-58	84	437	128	498	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.71e-58	84	437	140	510	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.75e-58	84	437	141	511	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.49e-56	84	509	273	700	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37653	1.23e-55	84	509	273	700	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	1.68e-55	84	509	273	700	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P58931	3.12e-55	84	463	159	535	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q93IN2	4.37e-55	84	509	273	700	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	5.98e-55	84	509	273	700	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
39	61
351	368
450	469
476	498