CAZyme Information: MGYG000003498_00566

Basic Information

• Species: UBA7173 sp900768685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900768685
• CAZyme ID: MGYG000003498_00566
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	MGYG000003498_18|CGC1	84408.21	7.8911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003498	2015725	MAG	Fiji	Oceania

• Gene Location: Start: 42037; End: 44334 Strand: +

Full Sequence      

MKLSVKSSAEKCVSFIKKNKKLVCIALPIVFLFLLWLFCLPENLFENTPYSTVVTDKNGE
LIGARVADDGQWRFPPCDTLPEKFVQALVEFEDRNFYSHCGVSPSALVRAVVQNVRNGRV
VSGGSTITMQVIRLSNPQPRNLWQKILEMFKATRLESRYTKDEILRMYASHAPFGGNVVG
INAAMWRYLGRHDAELSWAEAAALAVMQNCPSRITVFRNRELLLQKRNRLLGRLHDKGII
TDEEYAWAYDEPLIVMPESLPQYAPHLVEYYCRTAHGKNSRTEIDLSLQKRVEDLLASRS
REFRLCGVRDMAAIIIDVHSGEPVAYCGNADMDYDRDGKCVDIVQSPRSSGSILKPILYA
AAMNVGTILPQSLLPDVPMDFGGFAPKNFDGTYLGAVSADVALALSLNVPNVHLLKEYGV
MNFADLLKRAGFKTLTRPADKYGLSLILGGAEVTLRDVTMCYAKMAAICNDTANYPDFPL
RDRVALYRMFEAMYSVNRPDQMDLSRVSSVQNVAWKTGTSYGSRDAWAVGVTPDYVVGVW
VGNADGSGVSGLTGAKFAGPVMFELFGLLRGSSRFGLPNGNEGIMMSVCSQSGCPAGKNC
EKTHMMLVPKGCKNSKMCPYCREVAVSLDGNFRIADRSETTMTQNFFVLPPLMEHYYRPL
HPDYASLPPLKSTGSAVGAGQMHFISPANGSVISLARLADGSLGNLICKVAHSNPSAELF
WHIDNNFLGSTTHLHEMSVSPSAGYHKITVVDNFGASIELEIVIK

Enzyme Prediction     

No EC number prediction in MGYG000003498_00566.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	73	234	9.3e-46	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	41	765	1	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	0.0	21	765	6	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	7.67e-130	41	574	31	567	penicillin-binding protein 1C; Provisional
COG0744	MrcB	3.74e-100	47	567	51	594	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.51e-94	73	561	2	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL03299.1	0.0	32	764	16	748
AZS31496.1	0.0	34	765	18	747
AKA51279.1	2.09e-247	28	758	29	772
QRP90812.1	2.95e-247	28	758	29	772
CBW21957.1	2.95e-247	28	758	29	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	1.46e-35	45	543	118	668	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.59e-35	45	543	139	689	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
2OQO_A	3.23e-34	78	251	26	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.12e-33	78	251	26	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3FWL_A	1.90e-33	45	543	122	672	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	8.58e-101	41	569	33	564	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
O66874	4.52e-48	49	608	42	707	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q9KUC0	8.77e-46	60	558	167	703	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P38050	2.35e-41	51	542	48	569	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P45345	3.82e-40	60	558	156	693	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000023	0.000002	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
21	40