CAZyme Information: MGYG000003494_00645

Basic Information

• Species: Ruminiclostridium_E sp900768735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp900768735
• CAZyme ID: MGYG000003494_00645
• CAZy Family: GH5
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000003494_134|CGC1	45849.41	4.4743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003494	2318157	MAG	Fiji	Oceania

• Gene Location: Start: 457; End: 1698 Strand: +

Full Sequence      

MKKIIARLLAVCMLITAFGAFASGCNSSSTSGMSETSDSTGNHDNMPIRDISSVELVKEM
KIGWSLGNTLDAGNEGLRGSMPETLEKSWGNPVTTKEMIDTVKAAGFNIVRVPVTWDWST
GGAPDYTISEEWMNRVQEVVDYGIDNGMFIILNIHHETWHYPTEENYEAASDRLKKVWTQ
IGTRFSGYDEHLIFEGLNEPRVIGASEEWSGGSEATREIVNKLDADFVETIRSLGGNNTL
RHLMIPSYAASSTEQALAQLKIPENDDKIIVSVHAYLPYNFALADDGSQRWLAGKSGCTS
DIDTLADTIKTLFLDKGQAVIIGEFGARSRDNEEYRAEWGKYYVTKMKSIGVPCVWWDNG
SFSGSGELFGLLDRRTLEWRFPKVLDAIISASEGKYTLEELTQITTLPESESE

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	360	3.5e-100	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.50e-76	84	363	14	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	9.89e-44	52	392	43	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK96050.1	1.26e-215	2	407	5	412
CBL35038.1	4.00e-213	23	407	9	397
ADK66823.1	1.26e-135	48	393	28	367
CBL17440.1	1.53e-134	48	395	38	379
CCO06082.1	1.43e-123	2	388	4	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AYR_A	3.61e-118	48	388	15	356	GH5endoglucanase EglA from a ruminal fungus [Piromyces rhizinflatus]
3AYS_A	2.91e-117	48	388	15	356	GH5endoglucanase from a ruminal fungus in complex with cellotriose [Piromyces rhizinflatus]
6WQP_A	6.46e-116	48	389	11	353	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6PZ7_A	1.58e-114	50	390	6	335	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6MQ4_A	3.28e-113	48	392	7	349	ChainA, cellulase [Acetivibrio cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12647	1.25e-115	48	389	20	360	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P10477	1.59e-108	1	389	1	382	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P23660	7.00e-107	48	389	22	360	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	3.26e-106	48	397	38	377	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P23661	1.18e-105	43	394	61	402	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	24