CAZyme Information: MGYG000003493_01184

Basic Information

• Species: Prevotella sp002299275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002299275
• CAZyme ID: MGYG000003493_01184
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1000	MGYG000003493_141|CGC1	113411.44	6.9792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003493	3028354	MAG	Fiji	Oceania

• Gene Location: Start: 18490; End: 21492 Strand: -

Full Sequence      

MNNNEILSDYYQKNIAEMRGFAKKIVKNDFVAEDIVQDCFVRMLNIKEFIIERSLPALVH
KTLRNMCFDYLRCCSYRQQACQGLAYIQSSWHDMESEIYAHDLSEKLERGISTMSKRNQI
IYRMSIYEGKKVADITKTLGISYKATENCLGRARAEMRSFMRMCMSLVFIITMSIPSLAA
DKFVGFNGGDLHLNANGKVNIAVDDKDHEGVRIAARSLAIDIKNVTGCNASLDNNNATII
AGTIGASPVIDKILKQNKLTDQLKGKTEKFIITVISADKSLPQGGAGGGLLLIAGSDYRG
TIFGLYELSRQIGVSPWYWWADVPVAKHKDIYINKGIYTDGEPAVRYRGLFLNDEAPCLT
SWVENTFKTKNGGHEFYAKVFELILRLRGNMLWPAMWGWAFYADDPLNQKTANDMGVIIG
TSHHEPMARNHQEWARHRKEYGAWNYNTNKEVIKKFFREGIERMKGTDDIVTIGMRGDGD
EAMSEEADTRLLEQIVADQRKIIEEVTGKKAKETPQVWALYKEVMDYYDKGMRMPDDVIM
LLCDDNWGNVRRVPTAKERQHKGGWGLYYHVDYVGAPRNSKWINATPTQNMWEQLTLAAQ
YGIDRLWILNVGDLKPMEYPITLFMDMAWNPSQYDAATLTKHTEEFCRQQFGCCQAEEAA
RILNLCCKYNGRSTAEMLDATVYSTENGEWAKVVAQYDALEADALRQFVSLKEEYRDAYR
QIVLFPVQAMANLHRMYQAKAMNDMLVKAANGKYSEYVAAEINYWADRCAVAFRQDSLLC
DEYNTKMSGGKWNGMMIQKHIGYKSWNDAFPHDMMPKVARVEANAEGGNIIPCINGIANI
ETMAYYEKKDAANAQWTEIPFMGKSRSALSLQPYTASIDGASLTYKFACDNNAKEAKIYI
IVKSTLDFLNQDGFTYSVSVDGGEAQVVNFNGNLNEKPENIYDTYYPTIAKRVVENSVTV
TLKNSKNNTHTITITPNAPAIVFEKIVVDCTGQKQRISHL

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	196	986	3e-261	0.9856527977044476

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	341	677	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
TIGR02985	Sig70_bacteroi1	1.38e-26	9	161	9	161	RNA polymerase sigma-70 factor, Bacteroides expansion family 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found primarily in the genus Bacteroides. This family appears to have resulted from a lineage-specific expansion as B. thetaiotaomicron VPI-5482, Bacteroides forsythus ATCC 43037, Bacteroides fragilis YCH46 and Bacteroides fragilis NCTC 9343 contain 25, 12, 24 and 23 members, respectively. There are currentlyonly two known members of this family outside of the Bacteroides, in Rhodopseudomonas and Bradyrhizobium.
pfam17829	GH115_C	4.74e-25	835	1000	6	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
TIGR02937	sigma70-ECF	1.17e-18	5	161	1	158	RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.
COG1595	RpoE	2.97e-17	1	162	11	176	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family [Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34758.1	0.0	193	1000	3	795
QNT66545.1	0.0	174	997	19	849
BCS85271.1	0.0	166	994	8	819
ADE81569.1	0.0	166	996	11	816
QVJ82146.1	0.0	166	996	10	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	169	995	20	841	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	200	995	27	826	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	200	995	26	825	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.25e-170	187	828	2	643	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	8.73e-105	210	808	31	647	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003493_01184.