CAZyme Information: MGYG000003488_01082

Basic Information

• Species: CAG-488 sp900554995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp900554995
• CAZyme ID: MGYG000003488_01082
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000003488_17|CGC1	58487.93	4.9709

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003488	2291044	MAG	Fiji	Oceania

• Gene Location: Start: 50905; End: 52422 Strand: +

Full Sequence      

MLKERASGVLMHISSLPSKYGIGVFNDECIHFADRLAQMNFRYWQVLPFNPVDGSNSPYC
SSSAFAGNYMFIDPETLLKDGLCTEEEYRDNVYGGSPYTADYEFAGEKRLKLLKNAFLRI
TPELAQSVKNFEKENAWLTDFSLYMSLKEFNGMKPWWEWSEEQARYETFVKKHRYDFEER
SAFWKFVQYIFFSQWKKVKSYINSRGIAVIGDMPIYVSMDSADVWANRDLFLIDDRTLKP
QKIAGVPPDYFSKDGQLWGNPLYDWKAMEKDGYNWWLDRIGAAISTYDVVRIDHFRAFAS
FWQVPAESETARVGEWAKGPGMKLFDKVFEKYPDTPIIAEDLGVFGDDVVKLLEDTDFPG
MKVIQFGFDADGDSSHLPHNAVKNSVNYVGTHDNNTLLGWLWEADEKSRRFALDYCGFKG
ENWGEGGYRSQSCCSIIETVWRSVSNTAIISFQDLCGFGSDARMNIPGVADKNWRFRTTA
ETIDEVDTEYYKRINRIFKREYKVI

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	11	497	4.1e-152	0.9858299595141701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	500	1	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	11	477	1	456	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.09e-153	3	477	26	499	disproportionating enzyme
COG1640	MalQ	5.29e-146	3	504	12	518	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	5.70e-118	1	500	10	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT73240.1	1.06e-182	4	500	4	505
ARD65542.1	1.51e-182	4	500	4	505
ADO38582.1	3.03e-182	4	500	4	505
ALU15685.1	2.65e-166	39	500	1	467
AWW25287.1	2.81e-162	2	500	3	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	5.94e-136	5	501	22	504	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	1.06e-128	1	504	1	500	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
5CPQ_A	1.22e-118	4	489	69	550	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1X1N_A	2.62e-116	4	492	25	513	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
1FP8_A	7.12e-116	5	477	5	476	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	2.11e-142	11	500	1	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q1	3.15e-138	2	500	1	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	3.15e-138	2	500	1	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
O66937	8.55e-136	5	501	2	484	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P72785	7.15e-120	1	500	1	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003488_01082.