CAZyme Information: MGYG000003483_02683

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_02683
• CAZy Family: GH146
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		70063.88	7.4326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 299; End: 2179 Strand: -

Full Sequence      

MIQMKNGMACLVVAAAAATCIGEPAQVRLTGPFGERLDKMIRNHVTATDAVLLADRFHER
TREGWWQTEFWGKYMHSAVPFWKYSGSAELKGKIDAGLETLLKAQEPCGYIGNYPEARRC
GAGWDVWGMKYTMLGLIHYYDGTGDRRALDAARRLCDYLIGEVGPNGRRGVPLRHTGWYG
GLASCSVLEPVVWLYRRTGEARYLDFATYIVGQLCDGKDGPQLVRQADVPVAERRFEVVP
KAFEKNARVHLTKAYEMMSCYQGLLEYYEVTGDMSYLEAAVKTAESIRTTEVNLAGGAAA
GEHWFRGADRQYRHISWQQETCVLTTWMRLCAKLLALTGDPKWGDELEKTFYNAYLGALN
LNADKFASYSPLMGYRSVGHHHCKMHTDCCNANGPRGYLAVLSSYLLAEGDAVRVNLYMS
GHSSAVLPKTGKKVAFQCYTLYPREGTVGLWYRSREPQTFAFRLRIPAFSAKTTVLVNGQ
PVAGTPKAGCYFEIARTWNEGDAVEVRFDLPVVMHRLHDYVAFTRGPVCLARDTRFGDGA
LDEEIRAEQIGPDDLAAFRLVRPPTTDMFLALAADLPVGIHTEDPDAGKFPFSIHFTDYA
SAGDTWQPGARYRVWLPELIPGRDYQ

Enzyme Prediction     

No EC number prediction in MGYG000003483_02683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	63	531	1e-50	0.9085487077534792

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.28e-64	26	531	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.85e-46	26	613	16	555	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04434	LanC_like	4.69e-05	136	347	61	243	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04791	LanC_SerThrkinase	0.002	134	207	93	168	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.21e-125	26	620	26	610
AMV40735.1	1.55e-36	49	617	74	640
QEL26473.1	1.02e-35	87	615	104	630
BCH08653.1	6.75e-35	61	623	95	638
AGB29922.1	7.37e-35	88	532	111	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.87e-32	89	617	90	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	5.15e-32	27	532	16	554	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.29e-29	27	532	16	554	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	9.71e-23	74	532	142	601	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.137724	0.424797	0.435018	0.000967	0.000635	0.000841

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003483_02683.