CAZyme Information: MGYG000003482_01734

Basic Information

• Species: Selenomonas_C bovis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_C; Selenomonas_C bovis
• CAZyme ID: MGYG000003482_01734
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000003482_24|CGC1	65489.96	7.7598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003482	2265437	MAG	Fiji	Oceania

• Gene Location: Start: 53781; End: 55568 Strand: +

Full Sequence      

MVAEELLDWQLACDRFAREGDVRGMRACAQEVRAIGGAEAAREAQAMEADAALYAGDGGA
ARRLAAAVLAAEPAHLHARLVLAGADSRAFAIARALDRLRALQQDLERDLLPYTRGKPRG
AAAREKWARHRRALLYRALLFLADDAYLAAMPEEAAAALHKAAALAPDAGAAAALYSKYL
FMRNYRAQPDGEKRQEAALFGAFLSGVHPYLQEHILRVPGKRLRIGYISRDFRLHAMAYF
LAPFLRDFTPEAFSVYVYATGPVDEVTRRLRHFPVQWRDARGRSAHTAARLIAEDHIDIL
VDLSGHTQDNALPTLAYHAAPVQISGLGYVATTGLAAVDGFLVDRVTLPQGASETAFLER
IVRLPHCQFCYAPGAVREMPEVAPDIPYHRNGFVTFGSFNNLAKLSDETLLCWRAILDAL
PDSRLVLKGKTLSVPDGRALIRARLAALGLPVSRIELRPFSEHYLEEYRDIDIALDPTPY
TGGLTTCEALYMGVPVVTLRGRTHGSRFGASLLTAAALPELIAENEMEYVKKACALARHP
ELLANNHRKMRAHLQASRLMDAKAYMQDVERTYRALWEAYCQGGDDGAAQYPAAD

Enzyme Prediction     

No EC number prediction in MGYG000003482_01734.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	82	582	3.7e-104	0.5475177304964539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	1.61e-90	175	580	208	618	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	3.00e-28	209	568	67	542	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
cd03801	GT4_PimA-like	6.25e-05	413	580	214	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.78e-04	413	580	221	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03820	GT4_AmsD-like	0.001	393	498	167	284	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83943.1	4.21e-181	5	581	4	570
ANR71313.1	2.10e-179	3	581	12	581
QNH53886.1	2.98e-179	3	581	12	581
AOH48026.1	1.81e-178	3	581	12	581
AKT54951.1	6.34e-175	3	580	12	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	6.05e-61	153	588	94	529	Thermobaculumterrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
6Q4M_A	2.29e-26	209	583	224	712	Crystalstructure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
6IBO_A	3.05e-26	209	583	224	712	Catalyticdeficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]
5NPR_A	4.00e-26	209	583	218	706	Thehuman O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	4.01e-26	209	583	219	707	Thehuman O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RVB2	6.07e-72	180	583	443	852	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
Q96301	1.30e-71	180	583	438	847	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
O82039	1.96e-69	219	583	484	852	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
Q8LP10	4.39e-69	201	583	438	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum OX=52518 GN=SPY PE=2 SV=1
Q6YZI0	6.22e-68	217	583	468	838	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999176	0.000799	0.000032	0.000004	0.000002	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003482_01734.