CAZyme Information: MGYG000003482_01371

Basic Information

• Species: Selenomonas_C bovis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_C; Selenomonas_C bovis
• CAZyme ID: MGYG000003482_01371
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000003482_19|CGC3	41384.81	8.5696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003482	2265437	MAG	Fiji	Oceania

• Gene Location: Start: 124206; End: 125333 Strand: +

Full Sequence      

MRGKKLFVASLLMGIGAVFAACPVGAGRAEAAVMVAPNDAHLQYFGRWDKSNAQEYQCAQ
GAVYIKANFTGTSIKAKLRDPNDKWRVSIDGGAFQKIKPRGNETVLAENLKPGTHKLLFV
RSTEGYMGTTQFRGFELDDGARLEAPDPLKTRRLEFVGDSITAGAKNDGELKGENYNDIE
DNDQAYGPKVSRMLDADYSIVAKSGEGVVHNWADPWPSHQVHTADRYVWTMYSDRKEGSH
PRWDAKQFPVDATIVAMGTNDFSKPAKHSPTKEEFVAGYVNLIKTIRAVNPGKKIICTEP
VPNWGGKRGRAWVRAAVDQVTAEGMKDVYFIAINDPQPLLAESDYAHDSTHPLQTGHQKI
AAYLKDKIAAIMGWN

Enzyme Prediction     

No EC number prediction in MGYG000003482_01371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	153	368	4.6e-46	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	3.78e-28	153	364	1	164	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	1.52e-27	44	146	1	107	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam13472	Lipase_GDSL_2	5.20e-15	156	359	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	3.32e-13	156	367	3	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01827	sialate_O-acetylesterase_like1	2.91e-10	157	368	6	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83637.1	6.01e-152	1	374	1	361
ADO75380.1	7.01e-48	42	374	46	368
QKJ95934.1	1.93e-41	30	374	24	360
AEY66733.1	8.96e-39	46	374	116	436
QJD92660.1	3.74e-38	26	374	13	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	2.06e-36	42	374	11	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	5.56e-36	42	374	11	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2W9X_A	1.39e-23	56	296	48	290	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
2WAA_A	1.09e-18	35	374	13	339	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
4XVH_A	2.97e-16	42	289	2	242	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	8.21e-34	42	374	492	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	7.07e-23	56	296	48	290	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1
B3PIB0	2.66e-18	4	374	2	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000883	0.570580	0.427397	0.000599	0.000304	0.000213

TMHMM  Annotations     

start	end
7	29