CAZyme Information: MGYG000003482_01365

Basic Information

• Species: Selenomonas_C bovis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_C; Selenomonas_C bovis
• CAZyme ID: MGYG000003482_01365
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239	MGYG000003482_19|CGC3	27105.21	4.5921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003482	2265437	MAG	Fiji	Oceania

• Gene Location: Start: 116349; End: 117068 Strand: +

Full Sequence      

MVKRVLPGGDLNEVFNGYLDLVAEFDSELQAADVPLLFRPFHENTGSWFWWGAGHATPSD
FIALFQYTEKYLQEKGLHNMLYVYSPGGGELKSEGDYALTYPGSSYVDIAGFDMYHRDGE
RGDGFIEEDFSNVMDIVSGFAKAHHKVAAATETGMLVGNSALARTHNGYKGWFLDAAKVM
EKHHMAYFMTWSNFDETNFDQPYMVSDTRGHEMINDFIDFYNDPTTVFAKQNLDYAKLK

Enzyme Prediction     

No EC number prediction in MGYG000003482_01365.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	197	4.2e-41	0.5313531353135313

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	6.80e-28	6	140	124	251	Glycosyl hydrolase family 26.
COG4124	ManB2	3.74e-13	4	120	145	261	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83629.1	1.32e-70	3	239	209	443
BBK75947.1	8.14e-70	1	238	431	671
QMW91829.1	8.14e-70	1	238	431	671
QGH21752.1	8.33e-70	1	238	431	671
AXB85606.1	8.33e-70	1	238	431	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YN5_A	3.27e-41	1	231	177	417	Catalyticdomain of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase [Bacillus sp. JAMB750]
2BVT_A	2.16e-35	2	231	131	357	Thestructure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVT_B The structure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVY_A The structure and characterization of a modular endo-beta-1,4-mannanase from Cellulomonas fimi [Cellulomonas fimi]
2X2Y_A	5.68e-34	2	231	131	357	Cellulomonasfimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi],2X2Y_B Cellulomonas fimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi]
1J9Y_A	8.64e-33	6	230	134	371	Crystalstructure of mannanase 26A from Pseudomonas cellulosa [Cellvibrio japonicus]
1R7O_A	1.01e-32	6	230	144	381	CrystalStructure of apo-mannanase 26A from Psudomonas cellulosa [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	4.45e-35	1	236	160	403	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49424	8.28e-32	6	230	172	409	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
P49425	2.10e-18	19	156	289	410	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
O05512	2.58e-15	3	193	152	326	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	3.06e-14	19	127	167	278	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003482_01365.