CAZyme Information: MGYG000003481_01417

Basic Information

• Species: CAG-269 sp003525075
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp003525075
• CAZyme ID: MGYG000003481_01417
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	MGYG000003481_36|CGC3	59199.04	5.9651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003481	1646276	MAG	Fiji	Oceania

• Gene Location: Start: 103693; End: 105228 Strand: +

Full Sequence      

MTKRKKIIVICAFLLISFIIPNKVKAKESASVKYQTHVQDIGWQTQVKDGEIAGTEGQSK
RLEAIKIELKNLENIKIKYQTHIEDIGWQNWKYNGELTGTESQSKRLEAIKIELEYSEEY
SIMYRVHIQDIGWQEWKYDGEVAGTEGQSKRVEAIEIKLVDKSVFKVAYISHVEDVGWQN
WRYDGETAGTEGQSKRMEAIQIGFSNAPDGAKMRYKVHIQDIGWQDWKSDGQVAGTEGQS
KRIEAIQIELENLEDYTIEYKVHIQDIGWTNWYRDGEMAGTVGKGLRIEGIKIRIVSKYK
KHYIGIDVSHWQGDINYEKLVASQKIDFMITKVGWYSENNKRFIVDSKFEKNYKLAKQNK
IPLGIYLYSYAKNVEDAKLEANELIKYLKLSGNSSFELPIFYDIEEDSQISYGKKAITDI
TIAFCETMKNAGYEVGVYSYSYWLNNYMEILRLPADYSLWGADYGTNNNGQIPSDLDKYS
KTYDIWQFTDKAQIDGINGYVDMNVCYKKYF

Enzyme Prediction     

No EC number prediction in MGYG000003481_01417.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	306	497	5.5e-42	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.09e-62	305	507	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
COG5492	YjdB	2.11e-33	12	296	4	307	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
cd00599	GH25_muramidase	1.74e-29	305	505	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG5492	YjdB	2.45e-29	167	307	26	168	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
cd06524	GH25_YegX-like	2.45e-27	305	505	2	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT06404.1	8.18e-37	306	508	5	189
CED93768.1	1.91e-36	303	508	3	193
QCP33809.1	2.11e-35	302	504	45	243
ADU22071.1	7.85e-32	305	510	5	193
AQP40897.1	1.78e-31	306	504	48	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	2.31e-17	306	507	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
4KRU_A	3.37e-17	305	504	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WWC_A	5.46e-17	306	507	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRT_A	1.93e-16	305	504	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	7.45e-15	305	504	11	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P76421	2.10e-09	294	505	60	253	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	2.82e-09	294	505	60	253	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	9.15e-09	295	505	61	253	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000864	0.997745	0.000373	0.000356	0.000317	0.000267

TMHMM  Annotations     

start	end
7	24