CAZyme Information: MGYG000003481_01406

Basic Information

• Species: CAG-269 sp003525075
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp003525075
• CAZyme ID: MGYG000003481_01406
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000003481_36|CGC2	82035.8	7.746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003481	1646276	MAG	Fiji	Oceania

• Gene Location: Start: 88487; End: 90604 Strand: +

Full Sequence      

MEKKIDIYKHQKKKLKIENPKKVSVIIPNYNYEKYIIERIDSVLMQTYPIYEIVILDDCS
PDNSVKVINKKIDEIKKEHPEIKVQFIINEKNSGGCVFKQWKKGFNASTGDYIWIAEADD
SAENDFVENLIKPFDDPEVVLSYCESARIDGENNLIREKSDDLYDMCRTGEWNKSYIWPG
EKEIKEHLSVTNTILNVSSVMWKKQDYTEILEKAGEFKVAGDWYIYFNILKNGKISWCNK
PLNYYRKHGSSVCTDVKAEIEFNEICRIQDEISKTYELTKEIKDKQELRRSFMYPLLPKK
DNGKKKIAWVIPHPGKGSGGHRTIIQNVNALIRAGYDCDLYFEEDGVSTSEIVRQKINDW
YEKCDAGVYVGFDLKQEYDLMFATGWQTVEFVRKLPAKKKAYFIQDFEPWFFPMGDQYLI
TENSYRYGFLPVTIGKWLAHKMQAEFNTPAEYFSFGADLNVYKPLPKVKKENAICFVYQP
EKPRRCDYIGLKALKILKAMKPDVQIYLYGSSMPATFEFECKNLNIIPIKECNELYNKCK
VGICMSASNPSRIPFEMMSAGLPVVELYKENNIYDLPDEGVLLAQPIPEAIASAIAYILD
NPQVAEKMSKFGVQYMKNYPLEKGFEEYLKAVKDMLETDYKDIPEIKPLYKKSAFLATEE
AMKCSEELQKAQPIYVDNHGKTYRFLRRCKRVLKNILIKMGIKKQ

Enzyme Prediction     

No EC number prediction in MGYG000003481_01406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	24	174	3.2e-27	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.16e-28	24	157	1	126	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04196	GT_2_like_d	1.28e-27	24	252	1	209	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	1.56e-24	24	251	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	9.87e-23	25	144	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.47e-18	21	157	3	130	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA98902.1	9.91e-126	306	694	2	395
BCG61264.1	6.26e-124	306	697	3	392
QDY42390.1	8.51e-109	307	650	4	346
ADJ27856.1	2.00e-105	307	657	4	355
QBQ53520.1	2.12e-104	307	660	4	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.92e-12	17	283	1	257	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	1.13e-11	22	125	6	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2X0E_A	3.27e-08	377	629	132	413	Complexstructure of WsaF with dTDP [Geobacillus stearothermophilus],2X0E_B Complex structure of WsaF with dTDP [Geobacillus stearothermophilus],2X0F_A Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus],2X0F_B Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus]
2Z86_A	4.59e-08	1	156	352	502	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	4.59e-08	1	156	351	501	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	3.57e-15	379	632	992	1253	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P22639	1.93e-13	22	251	2	213	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
A0A0H2UR96	2.36e-10	23	188	5	176	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q57022	6.22e-09	23	157	6	132	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
A0A0H2URH7	9.81e-09	22	132	6	107	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003481_01406.