CAZyme Information: MGYG000003475_01196

Basic Information

• Species: Selenomonas_A sp900769615
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A; Selenomonas_A sp900769615
• CAZyme ID: MGYG000003475_01196
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003475_15|CGC3	42455.4	5.6708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003475	2184431	MAG	Fiji	Oceania

• Gene Location: Start: 105492; End: 106595 Strand: +

Full Sequence      

MKSYSKWMADSVIARKTDLTSYWAYEFGLTLDGIAEVWKQTGERKYFDYVKECMDTFVNE
DGTIRGYSVDEYNIDHLNNGKILLTIYQETHEEKYKKALALLRSQIENHPRTKEGVFWHK
EIYPEQIWLDGLYMGATFYAKYVSEFSKDMKEYDDIARQFIIARKHTIDPKSGLLYHAYD
DARQQPWADPVTGLSKHFWSRSMGWYCMALVDTLEQLPETNEYKAEIIKILNETMEALLK
VASKDSHVWYQVLDCGDRKGNYVEASGSCMIAYALFKGVRLGYLPEKMREFAKLSYQGLL
DEFICETPMHTINLNKICFVAGLGGKPTKAYGERDGSFAYYISEPIVTNEPKGLGPFILA
AAEYERL

Enzyme Prediction     

No EC number prediction in MGYG000003475_01196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	20	366	4.6e-115	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.44e-129	1	367	12	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.19e-108	4	367	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL81846.1	5.49e-243	1	367	1	367
QGH22292.1	4.76e-232	1	363	1	361
QGH26331.1	4.76e-232	1	363	1	361
AXB85181.1	6.76e-232	1	363	1	361
QUF84697.1	6.76e-232	1	363	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.35e-179	1	367	1	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.78e-80	23	367	39	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.46e-80	23	367	29	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	6.50e-14	23	366	66	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	2.81e-13	23	300	65	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.77e-80	23	367	39	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.71e-32	154	363	20	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.71e-32	154	363	20	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003475_01196.