CAZyme Information: MGYG000003475_00713

Basic Information

• Species: Selenomonas_A sp900769615
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A; Selenomonas_A sp900769615
• CAZyme ID: MGYG000003475_00713
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		24809.11	6.1574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003475	2184431	MAG	Fiji	Oceania

• Gene Location: Start: 102577; End: 103206 Strand: +

Full Sequence      

MEDRDELDDFTEKIRRDRCVQKRMATCFLVALFIFITSLGAYFVLQFEPVQRKYFYVYPY
HETVIKYAQVYHVDSNLTAAVIKSESKFKHEALSHRGAIGLMQLMPDTAEWIAAQIGDKN
YSLENLHEPDRNIRYGTWYLAELRKEFKGNDILALAAYNAGRGNVHEWIKENNWSDDFND
IDAIPYKETREYVKQVIIDRKKYHELYQE

Enzyme Prediction     

No EC number prediction in MGYG000003475_00713.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	76	197	1.7e-30	0.7481481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.24e-79	58	202	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.40e-61	56	197	2	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	7.86e-40	77	197	3	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.48e-34	28	196	98	276	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	6.03e-33	64	180	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83210.1	6.73e-118	10	209	4	203
BDA10554.1	7.34e-62	41	207	9	175
CBL05784.1	2.79e-61	32	207	9	184
AEC00057.1	2.98e-61	60	207	57	204
QIB61241.1	4.21e-61	41	207	9	175

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.25e-25	56	207	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.26e-25	56	207	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.27e-25	56	207	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.28e-25	56	207	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.30e-25	56	207	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.21e-19	66	196	66	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	4.26e-18	68	202	1430	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.26e-18	68	202	1430	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	6.41e-16	60	197	480	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	2.17e-15	60	197	480	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
25	47