CAZyme Information: MGYG000003475_00354

Basic Information

• Species: Selenomonas_A sp900769615
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A; Selenomonas_A sp900769615
• CAZyme ID: MGYG000003475_00354
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	MGYG000003475_4|CGC3	46368.74	9.9113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003475	2184431	MAG	Fiji	Oceania

• Gene Location: Start: 75267; End: 76532 Strand: -

Full Sequence      

MYNKQSILSFLLTGSILGTSILFNQSNAAAKAPVANRTITNRPAFSAKAPSEINKKAIRE
VHFKVTPAFDSPILAASSQPETISITGPAEATQEQMVNFINKRNAKPKLTCTVPEIVNYY
YQEAGREGIRPDVALCQALKETGFFGYGGDVSPKQNNFCGLGATGNHEPGASFATAQLGV
RAHIQHLLAYSSINRPQQAIIDPRYWHVVKNRPDLHGKVTNWTGLNGAWAVPGKNYGQEI
LRLWQEAQTPDASDISLTAANQKLKQSPADPNAYIYRGIVFFKRQNYTAAQQDFSKALQL
KPASSASLYNLGLTFTKLGKPKAAIKAYDDLLKISPNYNQGWYNRGLLHFEKHDFTKAAA
DMNALLNLEPRSADAQNLLGVISIKQKRYPDAWNDFYKAAAINSANMTVLANQFIIEACL
K

Enzyme Prediction     

No EC number prediction in MGYG000003475_00354.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	5.88e-19	271	366	1	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	1.11e-16	308	399	4	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	5.93e-12	264	333	28	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam01832	Glucosaminidase	1.62e-11	117	183	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02917	PEP_TPR_lipo	4.99e-11	257	392	179	314	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84275.1	5.33e-164	1	421	1	418
ALG42989.1	1.20e-102	56	413	41	396
AVO26228.1	1.75e-102	43	413	29	397
CCC73641.1	2.39e-102	43	413	28	396
AVO73547.1	2.39e-102	43	413	28	396

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	1.68e-15	113	246	68	194	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.046972	0.882229	0.064605	0.004754	0.000787	0.000620

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003475_00354.