CAZyme Information: MGYG000003466_01636

Basic Information

• Species: Treponema_D sp900767955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900767955
• CAZyme ID: MGYG000003466_01636
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000003466_45|CGC1	41137.21	5.0017

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003466	2580548	MAG	Fiji	Oceania

• Gene Location: Start: 6447; End: 7526 Strand: -

Full Sequence      

MKNKILKIWLLILIPFALFAGGKKDTLEADGVTEKVKPAYKKQIPQGAAIEFDEVWGYVM
KERESEFDTSMPITDVGYFAAEVNTYGELDGVPDRMFFEDYSGRVHLVVVCESKSLTHFV
LDPSYDVRKKLINQIMDAAKPYDGIQIDFELIPGRDADNFISFLKELSDLAKKQEKVFSV
CVPARVKTISDDVFPYKKIGDLADKVIVMAYDEHWSTSKAGPIASFKWCQKIVDYSVTVI
PQEKLVMGLPFYGRTWSEKKPAQAWYYSGINRIMKENGAKKVEYIDGIPSVKFNMDVEVT
GFFEDVNSVVQKMRLYDYKNVKNIAFWRIGQEDSDVWDWIKIKDTTANLEDSKETTETQ

Enzyme Prediction     

No EC number prediction in MGYG000003466_01636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	127	338	3.6e-36	0.7027027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.85e-55	54	338	3	311	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	4.04e-43	113	345	178	423	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.81e-29	112	337	75	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	8.96e-23	128	331	89	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	2.96e-21	128	331	92	333	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL96450.1	7.59e-122	2	343	4	352
AEB15386.1	1.58e-110	50	344	23	318
QQO08467.1	6.05e-103	23	344	30	351
QTQ11038.1	1.01e-102	46	341	127	419
QTQ17017.1	1.01e-102	46	341	127	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.02e-19	113	329	82	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	1.04e-15	142	337	105	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3K_A	2.32e-14	126	337	195	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4Q6T_A	3.77e-14	132	337	102	332	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4WIW_A	2.35e-12	128	333	97	333	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	1.72e-19	113	329	174	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	4.80e-18	128	341	116	340	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P37531	4.89e-15	38	337	97	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O31682	1.23e-12	128	262	82	218	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
Q9W092	2.63e-08	127	256	143	287	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008561	0.473803	0.516835	0.000279	0.000251	0.000239

TMHMM  Annotations     

start	end
5	22