CAZyme Information: MGYG000003466_01328

Basic Information

• Species: Treponema_D sp900767955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900767955
• CAZyme ID: MGYG000003466_01328
• CAZy Family: GT26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000003466_37|CGC2	28681.8	10.2543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003466	2580548	MAG	Fiji	Oceania

• Gene Location: Start: 193784; End: 194524 Strand: +

Full Sequence      

MGIQRINVVGVPVDVCRPEDLETEILELLAKPGTKQIVFLNIWGLLKARRKNDFAECVKN
ADLIIPISKSILNGAKFLKKEIPVRYNPFKAVIQILSVLDSHFKSLYLLGSRGQTLQIVE
KNVRDTFPSLRIVGRCRGYYQKNYETNVIQAIYKASPSLVLVSEGIAEKDCWSFRRRDQF
SSSIFVYYKDAFGIFSKRVKRVDEKVFDKGHEIFTEVLRNPLKIFLIFPFIWYTIVLIWY
RLFKKF

Enzyme Prediction     

No EC number prediction in MGYG000003466_01328.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	58	223	7.6e-23	0.9649122807017544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1922	WecG	1.14e-35	5	245	9	252	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
pfam03808	Glyco_tran_WecB	2.56e-28	61	225	1	166	Glycosyl transferase WecB/TagA/CpsF family.
cd06533	Glyco_transf_WecG_TagA	1.66e-11	58	162	1	105	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL96733.1	2.25e-124	1	245	1	245
QTQ13284.1	7.13e-121	1	245	1	245
QTQ15518.1	8.29e-120	1	245	1	245
QTQ12487.1	8.29e-120	1	245	1	245
QQA00783.1	2.46e-119	1	245	1	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	1.20e-20	3	212	1	210	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]
5WB4_A	9.32e-18	4	184	2	182	Crystalstructure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_B Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_C Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_D Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_E Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_F Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_G Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_H Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9]
5WFG_A	2.51e-17	4	184	2	182	Crystalstructure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_B Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_C Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_D Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_E Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_F Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
224	243