CAZyme Information: MGYG000003460_01897

Basic Information

• Species: Prevotellamassilia sp900546605
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900546605
• CAZyme ID: MGYG000003460_01897
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000003460_251|CGC1	42707.42	8.9512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003460	2573579	MAG	Fiji	Oceania

• Gene Location: Start: 6816; End: 7946 Strand: +

Full Sequence      

MKIFLIAGEASGDLHAAHLMQAIKREQPDVEFRYYGGDQMQAVGGTLLCHYRHLAYMGFV
QVVLHLRTILRGMRHCQQQIEEWRPDAVVLVDYPGFNLKIARFVKQQSICPVFYYISPKI
WAWKEHRIKAIRRDVDRLFSILPFEIDFFENKHHYPISYVGNPTVDEVAAYQATYGLPRP
DGRTIALLPGSRRQEIHDNLSRMLQAAAPFADYNLVIAQAPAIESDFYQRIIDSSHIHAA
RVSLVSGRTYELLSHATLALVTSGTATLETALFRVPQVVCYYMRAGWFISRVRPYFLKVP
YISLVNLIANCEVVPELVAADMNVRQLTRHLQALLPPNAPARQAQLQGYDGMAARLGEPG
APQRAAHEMLQLLAQR

Enzyme Prediction     

No EC number prediction in MGYG000003460_01897.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	356	2.5e-111	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.52e-110	1	376	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.28e-101	1	373	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.37e-73	3	318	1	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.75e-64	3	372	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.54e-52	1	327	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT93317.1	1.51e-148	1	373	1	376
ALJ61154.1	2.14e-148	1	373	1	376
QUT77942.1	2.47e-148	1	373	1	376
QFQ12469.1	7.26e-148	1	374	1	388
CBK68138.1	1.42e-147	1	373	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.39e-39	1	335	7	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.44e-39	1	335	7	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	9.08e-70	2	373	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B8JE78	5.79e-64	2	373	10	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	8.15e-64	2	373	10	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	2.49e-62	2	373	10	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q2LVL8	1.93e-61	3	373	6	378	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003460_01897.