CAZyme Information: MGYG000003424_00507

Basic Information

• Species: SFTJ01 sp004557385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp004557385
• CAZyme ID: MGYG000003424_00507
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606		67778.43	6.9807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003424	2699357	MAG	Fiji	Oceania

• Gene Location: Start: 4731; End: 6551 Strand: -

Full Sequence      

MKSLKTIISVLATGAMLSACSPKVTAPQAIGPLPSEHQLNWHEMETYAFIHFGLNTFADK
EWGYGDTPASSFNPSNLDCEQWVRTIKAAGMKGVIITTKHHDGFCLWPTQLTEYCIRNTP
YKQGKGDLVGELRAACDKYGLKLGLYLSPWDRNSAVYGTPEYVEYYHKQIEELTTRYGEL
FEFWLDGANGGDGYYGGAREMRQIDRRTFYDFPKIFAHILKNQPQAIIFSDGGPGCRWVG
NERGVASATNWAFLRGDEVYPGYPDYTTLQYGHADGTHWIPAECDVSIRPGWFFHESENS
KVRSAENLVDLYYKSVGHNSNFILNFPIDKTGRIPATDSINVCKARQIINAELANNILKG
VKPEASNSRGGRFSAAATTDGNSSTYWATADDVTSATIQFNIPRQKVNRMMLQEHIALGQ
RVQEFTVDYRDAQGNWQPVNAGEETTTIGYKRLLRFPTVETDGLRITIAKSRACPCIANI
EAYYGGAGSDKQYVDNSNNFKSVKFELTTHTDRFVMDLGGQREVNTLHYLPDADGMIAQY
EVYAGDTPETATTLVKKGEFSNIKNNPIVQTLRFAPVRARVIVLKATRMIEPGEPVKAKR
LGIEVL

Enzyme Prediction     

No EC number prediction in MGYG000003424_00507.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	36	338	1.5e-79	0.8265895953757225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	4.45e-58	26	477	3	424	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.65e-37	60	336	68	315	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.26e-35	49	336	31	317	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	5.27e-08	365	481	4	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM72241.1	6.58e-269	16	604	15	626
QCQ47058.1	6.58e-269	16	604	15	626
QCQ49587.1	6.58e-269	16	604	15	626
QCQ38415.1	6.58e-269	16	604	15	626
QLK84476.1	6.58e-269	16	604	15	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	3.25e-154	31	589	36	570	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	1.26e-118	33	606	31	585	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	2.03e-106	31	483	7	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	1.59e-97	34	482	19	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	1.90e-95	34	482	19	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.21e-105	9	518	13	506	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	9.24e-105	27	478	33	471	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	7.76e-09	57	200	74	224	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P10901	2.27e-08	57	187	82	223	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P17164	9.21e-08	40	148	76	180	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000040	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003424_00507.